AMPK beta 1 Antibody

Images

 
Western Blot: AMPK beta 1 Antibody [NBP1-57582] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related AMPK beta 1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57582
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

AMPK beta 1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PRKAB1(protein kinase, AMP-activated, beta 1 non-catalytic subunit) The peptide sequence was selected from the N terminal of PRKAB1. Peptide sequence KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW.
Clonality
Polyclonal
Host
Rabbit
Gene
PRKAB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PRKAB1 and was validated on Western blot.
Control
AMPK beta 1 Lysate (NBP2-64749)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AMPK beta 1 Antibody

  • 5'-AMP-activated protein kinase beta-1 subunit
  • AMP-activated protein kinase beta subunit
  • AMPK beta -1 chain
  • AMPK beta 1
  • AMPK beta 1,5'-AMP-activated protein kinase subunit beta-1
  • AMPK subunit beta-1
  • AMPK
  • AMPKb
  • HAMPKb
  • MGC17785
  • PRKAB1
  • protein kinase, AMP-activated, beta 1 non-catalytic subunit
  • protein kinase, AMP-activated, noncatalytic, beta-1

Background

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
7270-IL/CF
Species: Hu
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AMPK beta 1 Antibody (NBP1-57582) (0)

There are no publications for AMPK beta 1 Antibody (NBP1-57582).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPK beta 1 Antibody (NBP1-57582) (0)

There are no reviews for AMPK beta 1 Antibody (NBP1-57582). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMPK beta 1 Antibody (NBP1-57582) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for AMPK beta 1 Antibody (NBP1-57582)

Discover related pathways, diseases and genes to AMPK beta 1 Antibody (NBP1-57582). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMPK beta 1 Antibody (NBP1-57582)

Discover more about diseases related to AMPK beta 1 Antibody (NBP1-57582).
 

Pathways for AMPK beta 1 Antibody (NBP1-57582)

View related products by pathway.

PTMs for AMPK beta 1 Antibody (NBP1-57582)

Learn more about PTMs related to AMPK beta 1 Antibody (NBP1-57582).
 

Research Areas for AMPK beta 1 Antibody (NBP1-57582)

Find related products by research area.

Blogs on AMPK beta 1

There are no specific blogs for AMPK beta 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMPK beta 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAB1
Entrez
Uniprot