AMPK alpha 2 Antibody (1G8) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related AMPK alpha 2 Primary Antibodies

Order Details


    • Catalog Number
      H00005563-M02PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

AMPK alpha 2 Antibody (1G8) [PE] Summary

Immunogen
PRKAA2 (NP_006243 453 a.a. - 552 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR
Specificity
PRKAA2 - protein kinase, AMP-activated, alpha 2 catalytic subunit
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKAA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AMPK alpha 2 Antibody (1G8) [PE]

  • 5'-AMP-activated protein kinase catalytic subunit alpha-2
  • AMPK alpha 2
  • AMPK subunit alpha-2
  • AMPK2
  • AMPK5'-AMP-activated protein kinase, catalytic alpha-2 chain
  • AMPK-alpha-2 chain
  • EC 2.7.11
  • EC 2.7.11.1
  • PRKAA
  • PRKAA2
  • protein kinase, AMP-activated, alpha 2 catalytic subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005563-M02PE
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA

Publications for AMPK alpha 2 Antibody (H00005563-M02PE) (0)

There are no publications for AMPK alpha 2 Antibody (H00005563-M02PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMPK alpha 2 Antibody (H00005563-M02PE) (0)

There are no reviews for AMPK alpha 2 Antibody (H00005563-M02PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AMPK alpha 2 Antibody (H00005563-M02PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMPK alpha 2 Products

Bioinformatics Tool for AMPK alpha 2 Antibody (H00005563-M02PE)

Discover related pathways, diseases and genes to AMPK alpha 2 Antibody (H00005563-M02PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMPK alpha 2 Antibody (H00005563-M02PE)

Discover more about diseases related to AMPK alpha 2 Antibody (H00005563-M02PE).
 

Pathways for AMPK alpha 2 Antibody (H00005563-M02PE)

View related products by pathway.

PTMs for AMPK alpha 2 Antibody (H00005563-M02PE)

Learn more about PTMs related to AMPK alpha 2 Antibody (H00005563-M02PE).
 

Research Areas for AMPK alpha 2 Antibody (H00005563-M02PE)

Find related products by research area.

Blogs on AMPK alpha 2.

AMPK Alpha 1 and lipid metabolism of adipocytes
AMP-activated protein kinase (AMPK) is best known as a sensor of oxidative stress.  AMPK is activated by increased intracellular AMP levels, which are a result of alterations in cellular metabolism from causes such as hypoxia, changes in ATP, sene...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMPK alpha 2 Antibody (1G8) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAA2
Entrez