Amphiregulin Antibody

Images

 
Western Blot: Amphiregulin Antibody [H00000374-D01P] - Analysis of AREG expression in transfected 293T cell line by AREG polyclonal antibody.Lane 1: AREG transfected lysate(27.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Amphiregulin Antibody Summary

Immunogen
AREG (NP_001648.1, 1 a.a. - 252 a.a.) full-length human protein. MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA
Specificity
amphiregulin
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AREG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against mammalian transfected lysate in WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Amphiregulin Antibody

  • Amphiregulin
  • AR
  • AREG
  • AREGB
  • Colorectum cell-derived growth factor
  • CRDGF
  • MGC13647
  • schwannoma-derived growth factor
  • SDGF

Background

The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells, and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth factor alpha (TGF-alpha). This protein interacts with the EGF/TGF-alpha receptor to promote the growth of normal epithelial cells and inhibits the growth of certain aggressive carcinoma cell lines. This encoded protein is associated with a psoriasis-like skin phenotype. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000130-M01
Species: Hu
Applications: WB, ELISA
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Amphiregulin Antibody (H00000374-D01P) (0)

There are no publications for Amphiregulin Antibody (H00000374-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Amphiregulin Antibody (H00000374-D01P) (0)

There are no reviews for Amphiregulin Antibody (H00000374-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Amphiregulin Antibody (H00000374-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Amphiregulin Products

Bioinformatics Tool for Amphiregulin Antibody (H00000374-D01P)

Discover related pathways, diseases and genes to Amphiregulin Antibody (H00000374-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Amphiregulin Antibody (H00000374-D01P)

Discover more about diseases related to Amphiregulin Antibody (H00000374-D01P).
 

Pathways for Amphiregulin Antibody (H00000374-D01P)

View related products by pathway.

PTMs for Amphiregulin Antibody (H00000374-D01P)

Learn more about PTMs related to Amphiregulin Antibody (H00000374-D01P).
 

Research Areas for Amphiregulin Antibody (H00000374-D01P)

Find related products by research area.

Blogs on Amphiregulin

There are no specific blogs for Amphiregulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Amphiregulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AREG
Entrez
Uniprot