Amphiphysin/AMPH Antibody

Images

 
Western Blot: Amphiphysin Antibody [NBP1-55446] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Amphiphysin/AMPH Primary Antibodies

Order Details


    • Catalog Number
      NBP1-55446
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Amphiphysin/AMPH Antibody Summary

Immunogen
Synthetic peptides corresponding to AMPH(amphiphysin) The peptide sequence was selected from the N terminal of AMPH. Peptide sequence ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMPH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against AMPH and was validated on Western blot.
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Amphiphysin/AMPH Antibody

  • AMPH
  • AMPH1
  • amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen)
  • amphiphysin (Stiff-Mann syndrome with breast cancer 128kD autoantigen)
  • amphiphysin I
  • Amphiphysin

Background

AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.This gene encodes a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences have not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-67187
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, IP
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-56093
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-00178
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89102
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89695
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl, IHC-WhMt
NB500-418
Species: Hu, Po, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RIA, B/N
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-33419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02161
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB49281
Species: Hu
Applications: Flow, CyTOF-ready

Publications for Amphiphysin/AMPH Antibody (NBP1-55446) (0)

There are no publications for Amphiphysin/AMPH Antibody (NBP1-55446).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Amphiphysin/AMPH Antibody (NBP1-55446) (0)

There are no reviews for Amphiphysin/AMPH Antibody (NBP1-55446). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Amphiphysin/AMPH Antibody (NBP1-55446) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Amphiphysin/AMPH Products

Bioinformatics Tool for Amphiphysin/AMPH Antibody (NBP1-55446)

Discover related pathways, diseases and genes to Amphiphysin/AMPH Antibody (NBP1-55446). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Amphiphysin/AMPH Antibody (NBP1-55446)

Discover more about diseases related to Amphiphysin/AMPH Antibody (NBP1-55446).
 

Pathways for Amphiphysin/AMPH Antibody (NBP1-55446)

View related products by pathway.

PTMs for Amphiphysin/AMPH Antibody (NBP1-55446)

Learn more about PTMs related to Amphiphysin/AMPH Antibody (NBP1-55446).
 

Research Areas for Amphiphysin/AMPH Antibody (NBP1-55446)

Find related products by research area.

Blogs on Amphiphysin/AMPH

There are no specific blogs for Amphiphysin/AMPH, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Amphiphysin/AMPH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMPH
Uniprot