Recombinant Human Aminopeptidase PILS/ARTS1 Protein

Images

 

Order Details


    • Catalog Number
      H00051752-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Aminopeptidase PILS/ARTS1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 832-941 of Human ARTS-1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FPQILTLIGRNPVGYPLAWQFLRKNWNKLVQKFELGSSSIAHMVMGTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIGWMDKNFDKIRVWLQSEKLERM

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
ERAP1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Aminopeptidase PILS/ARTS1 Protein

  • Adipocyte-derived leucine aminopeptidase
  • A-LAP
  • A-LAPALAP
  • Aminopeptidase PILS
  • ARTS1
  • ARTS1aminopeptidase regulator of TNFR1 shedding
  • ARTS-1PILSAP
  • EC 3.4.11
  • EC 3.4.11.-
  • EC 3.4.11.1
  • endoplasmic reticulum aminopeptidase 1
  • endoplasmic reticulum aminopeptidase associated with antigen processing
  • ERAAP1
  • ERAP1
  • KIAA0525APPILS
  • PILS-AP
  • PILS-APERAAP
  • Puromycin-insensitive leucyl-specific aminopeptidase
  • Type 1 tumor necrosis factor receptor shedding aminopeptidase regulator

Background

ARTS-1 - type 1 tumor necrosis factor receptor shedding aminopeptidase regulator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6386
Species: Hu
Applications: WB, IP
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NB100-1885
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00051752-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01) (0)

There are no publications for Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01) (0)

There are no reviews for Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aminopeptidase PILS/ARTS1 Products

Bioinformatics Tool for Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01)

Discover related pathways, diseases and genes to Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01)

Discover more about diseases related to Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01).
 

Pathways for Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01)

View related products by pathway.

PTMs for Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01)

Learn more about PTMs related to Aminopeptidase PILS/ARTS1 Partial Recombinant Protein (H00051752-Q01).

Blogs on Aminopeptidase PILS/ARTS1

There are no specific blogs for Aminopeptidase PILS/ARTS1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Aminopeptidase PILS/ARTS1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ERAP1
Entrez