Aminopeptidase N/CD13 Antibody (1G1)

Images

 
Sandwich ELISA: Aminopeptidase N/CD13 Antibody (1G1) [H00000290-M05] - Detection limit for recombinant GST tagged ANPEP is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1G1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Aminopeptidase N/CD13 Antibody (1G1) Summary

Immunogen
ANPEP (AAH58928.1 858 a.a. - 967 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSNLIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK
Specificity
Reacts with alanyl (membrane) aminopeptidase.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ANPEP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aminopeptidase N/CD13 Antibody (1G1)

  • alanyl (membrane) aminopeptidase
  • Alanyl aminopeptidase
  • Aminopeptidase M
  • Aminopeptidase N
  • ANPEP
  • AP-M
  • APN
  • AP-N
  • CD13 antigen
  • CD13
  • CD13APN
  • EC 3.4.11
  • EC 3.4.11.2
  • gp150
  • LAP1
  • Microsomal aminopeptidase
  • Myeloid plasma membrane glycoprotein CD13
  • p150
  • PEPN
  • PEPNhAPN

Background

Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. Human aminopeptidase N is a receptor for one strain of human coronavirus that is an important cause of upper respiratory tract infections. Defects in this gene appear to be a cause of various types of leukemia or lymphoma. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1885
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
AF7579
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000290-M05
Species: Hu
Applications: ELISA

Publications for Aminopeptidase N/CD13 Antibody (H00000290-M05) (0)

There are no publications for Aminopeptidase N/CD13 Antibody (H00000290-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminopeptidase N/CD13 Antibody (H00000290-M05) (0)

There are no reviews for Aminopeptidase N/CD13 Antibody (H00000290-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Aminopeptidase N/CD13 Antibody (H00000290-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aminopeptidase N/CD13 Products

Bioinformatics Tool for Aminopeptidase N/CD13 Antibody (H00000290-M05)

Discover related pathways, diseases and genes to Aminopeptidase N/CD13 Antibody (H00000290-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aminopeptidase N/CD13 Antibody (H00000290-M05)

Discover more about diseases related to Aminopeptidase N/CD13 Antibody (H00000290-M05).
 

Pathways for Aminopeptidase N/CD13 Antibody (H00000290-M05)

View related products by pathway.

Research Areas for Aminopeptidase N/CD13 Antibody (H00000290-M05)

Find related products by research area.

Blogs on Aminopeptidase N/CD13

There are no specific blogs for Aminopeptidase N/CD13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aminopeptidase N/CD13 Antibody (1G1) and receive a gift card or discount.

Bioinformatics

Gene Symbol ANPEP
Entrez
Uniprot