Aminoacylase/ACY1 Antibody (4F1-B7) [DyLight 405]

Images

 

Product Details

Summary
Product Discontinued
View other related Aminoacylase/ACY1 Primary Antibodies

Order Details


    • Catalog Number
      H00000095-M01V
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Aminoacylase/ACY1 Antibody (4F1-B7) [DyLight 405] Summary

Immunogen
ACY1 (AAH00545, 1 a.a. - 408 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Specificity
ACY1 - aminoacylase 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACY1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aminoacylase/ACY1 Antibody (4F1-B7) [DyLight 405]

  • ACY1
  • ACY-1
  • ACY1D
  • acylase
  • aminoacylase 1
  • Aminoacylase
  • aminoacylase-1
  • EC 3.5.1
  • EC 3.5.1.14
  • N-acyl-L-amino-acid amidohydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-84305
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85332
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Aminoacylase/ACY1 Antibody (H00000095-M01V) (0)

There are no publications for Aminoacylase/ACY1 Antibody (H00000095-M01V).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminoacylase/ACY1 Antibody (H00000095-M01V) (0)

There are no reviews for Aminoacylase/ACY1 Antibody (H00000095-M01V). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aminoacylase/ACY1 Antibody (H00000095-M01V) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aminoacylase/ACY1 Products

Related Products by Gene

Bioinformatics Tool for Aminoacylase/ACY1 Antibody (H00000095-M01V)

Discover related pathways, diseases and genes to Aminoacylase/ACY1 Antibody (H00000095-M01V). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aminoacylase/ACY1 Antibody (H00000095-M01V)

Discover more about diseases related to Aminoacylase/ACY1 Antibody (H00000095-M01V).
 

Pathways for Aminoacylase/ACY1 Antibody (H00000095-M01V)

View related products by pathway.

PTMs for Aminoacylase/ACY1 Antibody (H00000095-M01V)

Learn more about PTMs related to Aminoacylase/ACY1 Antibody (H00000095-M01V).

Blogs on Aminoacylase/ACY1

There are no specific blogs for Aminoacylase/ACY1, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Aminoacylase/ACY1 Antibody (4F1-B7) [DyLight 405] and receive a gift card or discount.

Bioinformatics

Gene Symbol ACY1
Entrez
Uniprot