Aminoacylase/ACY1 Antibody (4F1-B7) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Aminoacylase/ACY1 Primary Antibodies

Order Details


    • Catalog Number
      H00000095-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Aminoacylase/ACY1 Antibody (4F1-B7) [DyLight 488] Summary

Immunogen
ACY1 (AAH00545, 1 a.a. - 408 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Specificity
ACY1 - aminoacylase 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACY1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aminoacylase/ACY1 Antibody (4F1-B7) [DyLight 488]

  • ACY1
  • ACY-1
  • ACY1D
  • acylase
  • aminoacylase 1
  • Aminoacylase
  • aminoacylase-1
  • EC 3.5.1
  • EC 3.5.1.14
  • N-acyl-L-amino-acid amidohydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85332
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000095-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for Aminoacylase/ACY1 Antibody (H00000095-M01G) (0)

There are no publications for Aminoacylase/ACY1 Antibody (H00000095-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aminoacylase/ACY1 Antibody (H00000095-M01G) (0)

There are no reviews for Aminoacylase/ACY1 Antibody (H00000095-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aminoacylase/ACY1 Antibody (H00000095-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aminoacylase/ACY1 Products

Bioinformatics Tool for Aminoacylase/ACY1 Antibody (H00000095-M01G)

Discover related pathways, diseases and genes to Aminoacylase/ACY1 Antibody (H00000095-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aminoacylase/ACY1 Antibody (H00000095-M01G)

Discover more about diseases related to Aminoacylase/ACY1 Antibody (H00000095-M01G).
 

Pathways for Aminoacylase/ACY1 Antibody (H00000095-M01G)

View related products by pathway.

PTMs for Aminoacylase/ACY1 Antibody (H00000095-M01G)

Learn more about PTMs related to Aminoacylase/ACY1 Antibody (H00000095-M01G).

Blogs on Aminoacylase/ACY1

There are no specific blogs for Aminoacylase/ACY1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aminoacylase/ACY1 Antibody (4F1-B7) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol ACY1
Entrez