Recombinant Human AlphaB Crystallin/CRYAB Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AlphaB Crystallin/CRYAB Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-175 of Human CRYAB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLPEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKRVSGPERTIPITREEKPAVTAAPKK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
CRYAB

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AlphaB Crystallin/CRYAB Protein

  • alpha B crystallin
  • alpha(B)-crystallin
  • AlphaB Crystallin
  • alpha-crystallin B chain
  • CRYA2
  • CRYA2alpha crystallin B chain
  • CRYAB
  • crystallin, alpha B
  • CTPP2
  • Heat shock protein beta-5
  • heat-shock 20 kD like-protein
  • HSPB5
  • Renal carcinoma antigen NY-REN-27
  • Rosenthal fiber component

Background

CRYAB( AAH07008, 1 a.a. - 176 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-46354
Species: Hu
Applications: WB, IHC, IF
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02576
Species: Hu, Rt, Mk
Applications: WB, Flow, ICC/IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
MAB4200
Species: Hu, Mu, Rt
Applications: WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF2584
Species: Mu
Applications: WB, Simple Western
31310002
Species: Hu
Applications: WB, ELISA
H00001415-M02
Species: Hu
Applications: WB, ELISA
NBP1-32557
Species: Hu
Applications: WB
NBP1-87851
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00001410-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01) (0)

There are no publications for AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01) (0)

There are no reviews for AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AlphaB Crystallin/CRYAB Products

Bioinformatics Tool for AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01)

Discover related pathways, diseases and genes to AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01)

Discover more about diseases related to AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01).
 

Pathways for AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01)

View related products by pathway.

PTMs for AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01)

Learn more about PTMs related to AlphaB Crystallin/CRYAB Recombinant Protein (H00001410-P01).

Blogs on AlphaB Crystallin/CRYAB

There are no specific blogs for AlphaB Crystallin/CRYAB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AlphaB Crystallin/CRYAB Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYAB
Entrez