alpha-Internexin Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human INA. Source: E. coli Amino Acid Sequence: ALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
INA |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81007. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for alpha-Internexin Recombinant Protein Antigen
Background
Alpha-internexin is a Class IV intermediate filament, related to but distinct from the better known neurofilament triplet proteins, NF-L, NF-M and NF-H. It is expressed only in neurons and in large amounts early in neuronal development, but is down-regulated in many neurons as development procedes. However, many classes of mature neurons contain alpha-internexin in addition to NF-L, NF-M and NF-H, and some mature neurons only express the alpha-internexin subunit of neurofilament.
The very early developmental expression of alpha-internexin suggests that its presence is an early and convenient diagnostic feature of neuronal progenitors cells and other cell committed to the neuronal lineage. Therefore, alpha-internexin antibodies serve as unique probes to study and classify neuronal types and follow their processes in tissue sections and culture.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Bv, Ch, Dr, Eq, Hu, Mu, Po, Rt
Applications: IB, ICC/IF, IHC-FrFl, IHC, KD, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: AC
Publications for alpha-Internexin Recombinant Protein Antigen (NBP1-81007PEP) (0)
There are no publications for alpha-Internexin Recombinant Protein Antigen (NBP1-81007PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for alpha-Internexin Recombinant Protein Antigen (NBP1-81007PEP) (0)
There are no reviews for alpha-Internexin Recombinant Protein Antigen (NBP1-81007PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for alpha-Internexin Recombinant Protein Antigen (NBP1-81007PEP) (0)
Additional alpha-Internexin Products
Research Areas for alpha-Internexin Recombinant Protein Antigen (NBP1-81007PEP)
Find related products by research area.
|
Blogs on alpha-Internexin