Recombinant Human alpha-Aminoadipate Aminotransferase Protein

Order Details


    • Catalog Number
      H00051166-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human alpha-Aminoadipate Aminotransferase Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-429 of Human AADAT full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNYARFITAASAARNPSPIRTMSEKRADILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYQPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESL

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
AADAT

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human alpha-Aminoadipate Aminotransferase Protein

  • AADAT
  • alphaAminoadipate Aminotransferase
  • alpha-Aminoadipate Aminotransferase
  • aminoadipate aminotransferase
  • EC 2.6.1.39,2-aminoadipate aminotransferase
  • EC 2.6.1.7,2-aminoadipate transaminase
  • KAT/AadAT
  • KAT2
  • KAT2mitochondrial
  • Kynurenine aminotransferase II
  • Kynurenine--oxoglutarate aminotransferase II
  • Kynurenine--oxoglutarate transaminase II
  • L kynurenine/alpha aminoadipate aminotransferase

Background

This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Two alternative transcripts encoding the same isoform have been identified, however, additional alternative transcripts and isoforms may exist. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01383
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1103
Species: Hu
Applications: WB, IHC, ICC
AF7817
Species: Hu, Mu, Rt
Applications: WB
NBP1-87835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29936
Species: Hu, Mu
Applications: WB, Flow, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
MAB7389
Species: Mu
Applications: WB, IHC
AF23151
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-48549
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00051166-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01) (0)

There are no publications for alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01) (0)

There are no reviews for alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha-Aminoadipate Aminotransferase Products

Bioinformatics Tool for alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01)

Discover related pathways, diseases and genes to alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01)

Discover more about diseases related to alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01).
 

Pathways for alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01)

View related products by pathway.

PTMs for alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01)

Learn more about PTMs related to alpha-Aminoadipate Aminotransferase Recombinant Protein (H00051166-P01).

Blogs on alpha-Aminoadipate Aminotransferase

There are no specific blogs for alpha-Aminoadipate Aminotransferase, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human alpha-Aminoadipate Aminotransferase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AADAT
Entrez