alpha 2-Macroglobulin-like 1/A2ML1 Antibody

Images

 
Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Staining of human esophagus shows high expression.
Independent Antibodies: Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Staining of human esophagus, liver, skin and tonsil using Anti-A2ML1 antibody NBP2-32647 (A) shows ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Analysis in human esophagus and liver tissues. Corresponding A2ML1 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.
Immunohistochemistry-Paraffin: alpha 2-Macroglobulin-like 1/A2ML1 Antibody [NBP2-32647] - Staining of human tonsil shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

alpha 2-Macroglobulin-like 1/A2ML1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MTFEDTSNFYHPNFPFSGKIRVRGHDDSFLKNHLVFLVIYGTNGTFNQTLVTDNNGLAPFTLETSGWNGTDVSLEGKFQMEDLVYNPEQVPRYYQ
Specificity
Specificity of human alpha 2-Macroglobulin-like 1/A2ML1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
A2ML1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for alpha 2-Macroglobulin-like 1/A2ML1 Antibody

  • A2ML1
  • alpha 2Macroglobulin like 1
  • alpha 2-Macroglobulin-like 1
  • alpha-2-macroglobulin-like 1
  • alpha-2-macroglobulin-like protein 1
  • C3 and PZP-like, alpha-2-macroglobulin domain containing 9
  • CPAMD9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-67286
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC
AF1408
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IP, KO
H00010438-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB8280
Species: Hu
Applications: WB, ELISA
7270-IL/CF
Species: Hu
NBP2-32647
Species: Hu
Applications: IHC, IHC-P

Publications for alpha 2-Macroglobulin-like 1/A2ML1 Antibody (NBP2-32647) (0)

There are no publications for alpha 2-Macroglobulin-like 1/A2ML1 Antibody (NBP2-32647).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha 2-Macroglobulin-like 1/A2ML1 Antibody (NBP2-32647) (0)

There are no reviews for alpha 2-Macroglobulin-like 1/A2ML1 Antibody (NBP2-32647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for alpha 2-Macroglobulin-like 1/A2ML1 Antibody (NBP2-32647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional alpha 2-Macroglobulin-like 1/A2ML1 Products

Bioinformatics Tool for alpha 2-Macroglobulin-like 1/A2ML1 Antibody (NBP2-32647)

Discover related pathways, diseases and genes to alpha 2-Macroglobulin-like 1/A2ML1 Antibody (NBP2-32647). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha 2-Macroglobulin-like 1/A2ML1 Antibody (NBP2-32647)

Discover more about diseases related to alpha 2-Macroglobulin-like 1/A2ML1 Antibody (NBP2-32647).
 

Pathways for alpha 2-Macroglobulin-like 1/A2ML1 Antibody (NBP2-32647)

View related products by pathway.

Blogs on alpha 2-Macroglobulin-like 1/A2ML1

There are no specific blogs for alpha 2-Macroglobulin-like 1/A2ML1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha 2-Macroglobulin-like 1/A2ML1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol A2ML1