alpha 1-Microglobulin Antibody (3F1) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related alpha 1-Microglobulin Primary Antibodies

Order Details


    • Catalog Number
      H00000259-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

alpha 1-Microglobulin Antibody (3F1) [PE] Summary

Immunogen
AMBP (AAH41593, 19 a.a. - 352 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
Specificity
AMBP - alpha-1-microglobulin/bikunin precursor
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AMBP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for alpha 1-Microglobulin Antibody (3F1) [PE]

  • A1M
  • alpha 1Microglobulin
  • alpha 1-Microglobulin
  • alpha-1-microglobulin/bikunin precursor
  • AMBP
  • bikunin
  • EDC1
  • HCP
  • HCPcomplex-forming glycoprotein heterogeneous in charge
  • HI30
  • IATIL
  • inter-alpha-trypsin inhibitor light chain
  • ITI
  • ITIL
  • ITILC
  • ITILgrowth-inhibiting protein 19
  • protein AMBP
  • protein HC
  • trypstatin
  • uristatin
  • uronic-acid-rich protein
  • UTI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00000259-M01PE
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for alpha 1-Microglobulin Antibody (H00000259-M01PE) (0)

There are no publications for alpha 1-Microglobulin Antibody (H00000259-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha 1-Microglobulin Antibody (H00000259-M01PE) (0)

There are no reviews for alpha 1-Microglobulin Antibody (H00000259-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for alpha 1-Microglobulin Antibody (H00000259-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha 1-Microglobulin Products

Bioinformatics Tool for alpha 1-Microglobulin Antibody (H00000259-M01PE)

Discover related pathways, diseases and genes to alpha 1-Microglobulin Antibody (H00000259-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha 1-Microglobulin Antibody (H00000259-M01PE)

Discover more about diseases related to alpha 1-Microglobulin Antibody (H00000259-M01PE).
 

Pathways for alpha 1-Microglobulin Antibody (H00000259-M01PE)

View related products by pathway.

PTMs for alpha 1-Microglobulin Antibody (H00000259-M01PE)

Learn more about PTMs related to alpha 1-Microglobulin Antibody (H00000259-M01PE).

Blogs on alpha 1-Microglobulin

There are no specific blogs for alpha 1-Microglobulin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha 1-Microglobulin Antibody (3F1) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol AMBP
Entrez