Alkaline Ceramidase 2 Antibody

Images

 
Immunohistochemistry: Alkaline Ceramidase 2 Antibody [NBP1-90089] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Alkaline Ceramidase 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DAASEIPEQGPVIKFWPNEKWAFIGVPYVSLLCANKKSSVKIT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACER2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Alkaline Ceramidase 2 Antibody

  • Acylsphingosine deacylase 3-like
  • Alkaline CDase 2
  • alkaline ceramidase 2
  • AlkCDase 2
  • ALKCDase2
  • ASAH3L
  • ceramide hydrolase
  • EC 3.5.1.23
  • FLJ41587
  • haCER2
  • N-acylsphingosine amidohydrolase 3-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-74083
Species: Hu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP2-49326
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59941
Species: Hu
Applications: WB, IHC
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008877-M01
Species: Hu
Applications: WB, ELISA
NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC

Publications for Alkaline Ceramidase 2 Antibody (NBP1-90089) (0)

There are no publications for Alkaline Ceramidase 2 Antibody (NBP1-90089).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Alkaline Ceramidase 2 Antibody (NBP1-90089) (0)

There are no reviews for Alkaline Ceramidase 2 Antibody (NBP1-90089). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Alkaline Ceramidase 2 Antibody (NBP1-90089) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Alkaline Ceramidase 2 Products

Bioinformatics Tool for Alkaline Ceramidase 2 Antibody (NBP1-90089)

Discover related pathways, diseases and genes to Alkaline Ceramidase 2 Antibody (NBP1-90089). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Alkaline Ceramidase 2 Antibody (NBP1-90089)

Discover more about diseases related to Alkaline Ceramidase 2 Antibody (NBP1-90089).
 

Pathways for Alkaline Ceramidase 2 Antibody (NBP1-90089)

View related products by pathway.

PTMs for Alkaline Ceramidase 2 Antibody (NBP1-90089)

Learn more about PTMs related to Alkaline Ceramidase 2 Antibody (NBP1-90089).
 

Research Areas for Alkaline Ceramidase 2 Antibody (NBP1-90089)

Find related products by research area.

Blogs on Alkaline Ceramidase 2

There are no specific blogs for Alkaline Ceramidase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Alkaline Ceramidase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACER2
Entrez
Uniprot