ALK/CD246 Antibody (4D10)

Images

 
Western Blot: ALK/CD246 Antibody (4D10) [H00000238-M01] - Detection against Immunogen (36.74 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ALK/CD246 Antibody (4D10) Summary

Immunogen
ALK (NP_004295, 251 a.a. - 350 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVS
Specificity
MFAP3 - microfibrillar-associated protein 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ALK
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ALK/CD246 Antibody (4D10)

  • ALK tyrosine kinase receptor
  • ALK
  • anaplastic lymphoma kinase (Ki-1)
  • Anaplastic lymphoma kinase
  • anaplastic lymphoma receptor tyrosine kinase
  • CD246 antigen
  • CD246
  • EC 2.7.10.1
  • Ki-1
  • NBLST3
  • Tcrz

Background

The 2;5 chromosomal translocation is frequently associated with anaplastic large cell lymphomas (ALCLs). The translocation creates a fusion gene consisting of the ALK (anaplastic lymphoma kinase) gene and the nucleophosmin (NPM) gene: the 3' half of ALK, derived from chromosome 2, is fused to the 5' portion of NPM from chromosome 5. A recent study shows that the product of the NPM-ALK fusion gene is oncogenic. The deduced amino acid sequences reveal that ALK is a novel receptor protein-tyrosine kinase having a putative transmembrane domain and an extracellular domain. These sequences are absent in the product of the transforming NPM-ALK gene. ALK shows the greatest sequence similarity to LTK (leukocyte tyrosine kinase). ALK plays an important role in the development of the brain and exerts its effects on specific neurons in the nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF7250
Species: Hu
Applications: IHC
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-86805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF770
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF3025
Species: Hu
Applications: WB, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF-252-PB
Species: Hu
Applications: WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000238-M01
Species: Hu
Applications: WB, ELISA

Publications for ALK/CD246 Antibody (H00000238-M01) (0)

There are no publications for ALK/CD246 Antibody (H00000238-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALK/CD246 Antibody (H00000238-M01) (0)

There are no reviews for ALK/CD246 Antibody (H00000238-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALK/CD246 Antibody (H00000238-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALK/CD246 Products

Bioinformatics Tool for ALK/CD246 Antibody (H00000238-M01)

Discover related pathways, diseases and genes to ALK/CD246 Antibody (H00000238-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALK/CD246 Antibody (H00000238-M01)

Discover more about diseases related to ALK/CD246 Antibody (H00000238-M01).
 

Pathways for ALK/CD246 Antibody (H00000238-M01)

View related products by pathway.

PTMs for ALK/CD246 Antibody (H00000238-M01)

Learn more about PTMs related to ALK/CD246 Antibody (H00000238-M01).
 

Research Areas for ALK/CD246 Antibody (H00000238-M01)

Find related products by research area.

Blogs on ALK/CD246

There are no specific blogs for ALK/CD246, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALK/CD246 Antibody (4D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ALK
Entrez
OMIM
Uniprot