Recombinant Human ALK-7/Activin Receptor Type 1C Protein

Order Details


    • Catalog Number
      H00130399-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ALK-7/Activin Receptor Type 1C Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 23 - 112 of Human ACVR1C partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPM

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACVR1C

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
25 mM Tris-HCl, pH 7.5, 2 mM 2-ME, 1 mM EDTA

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALK-7/Activin Receptor Type 1C Protein

  • activin A receptor, type IC
  • Activin receptor type IC
  • activin receptor type-1C
  • Activin receptor-like kinase 7
  • Activin RIC
  • ACTR-IC
  • ACVR1C
  • ACVRLK7
  • ALK7
  • ALK-7
  • ALK7ALK-7
  • EC 2.7.11
  • EC 2.7.11.30

Background

ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1477
Species: Mu
Applications: WB, IHC, Block
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ICC
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
AF958
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF4210
Species: Hu
Applications: WB, IHC
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-87518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2097
Species: Hu
Applications: WB, ChIP, ICC
MAB6937
Species: Hu
Applications: WB

Publications for Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01) (0)

There are no publications for Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01) (0)

There are no reviews for Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALK-7/Activin Receptor Type 1C Products

Bioinformatics Tool for Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01)

Discover related pathways, diseases and genes to Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01)

Discover more about diseases related to Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01).
 

Pathways for Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01)

View related products by pathway.

PTMs for Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01)

Learn more about PTMs related to Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01).
 

Research Areas for Activin Receptor Type 1C Partial Recombinant Protein (H00130399-Q01)

Find related products by research area.

Blogs on ALK-7/Activin Receptor Type 1C

There are no specific blogs for ALK-7/Activin Receptor Type 1C, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALK-7/Activin Receptor Type 1C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACVR1C
Entrez