ALK-7/Activin Receptor Type 1C Antibody


Western Blot: Activin A Receptor Type IC Antibody [NBP1-69657] - This Anti-ACVR1C antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ALK-7/Activin Receptor Type 1C Antibody Summary

Synthetic peptides corresponding to ACVR1C(activin A receptor, type IC) The peptide sequence was selected from the N terminal of ACVR1C. Peptide sequence QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACVR1C and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ALK-7/Activin Receptor Type 1C Antibody

  • activin A receptor, type IC
  • Activin receptor type IC
  • activin receptor type-1C
  • Activin receptor-like kinase 7
  • Activin RIC
  • ACVR1C
  • ALK7
  • ALK-7
  • ALK7ALK-7
  • EC 2.7.11
  • EC


ACVR1C is a type I receptor for the TGFB family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors.ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]).[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Block
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
Species: Hu
Applications: WB, ELISA, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ChIP, ICC
Species: Hu
Applications: WB

Publications for Activin Receptor Type 1C Antibody (NBP1-69657) (0)

There are no publications for Activin Receptor Type 1C Antibody (NBP1-69657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Activin Receptor Type 1C Antibody (NBP1-69657) (0)

There are no reviews for Activin Receptor Type 1C Antibody (NBP1-69657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Activin Receptor Type 1C Antibody (NBP1-69657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALK-7/Activin Receptor Type 1C Products

Bioinformatics Tool for Activin Receptor Type 1C Antibody (NBP1-69657)

Discover related pathways, diseases and genes to Activin Receptor Type 1C Antibody (NBP1-69657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Activin Receptor Type 1C Antibody (NBP1-69657)

Discover more about diseases related to Activin Receptor Type 1C Antibody (NBP1-69657).

Pathways for Activin Receptor Type 1C Antibody (NBP1-69657)

View related products by pathway.

PTMs for Activin Receptor Type 1C Antibody (NBP1-69657)

Learn more about PTMs related to Activin Receptor Type 1C Antibody (NBP1-69657).

Research Areas for Activin Receptor Type 1C Antibody (NBP1-69657)

Find related products by research area.

Blogs on ALK-7/Activin Receptor Type 1C

There are no specific blogs for ALK-7/Activin Receptor Type 1C, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ALK-7/Activin Receptor Type 1C Antibody and receive a gift card or discount.


Gene Symbol ACVR1C