ALK-1 Antibody (1E7.)

Images

 
Sandwich ELISA: ALK-1 Antibody (1E7) [H00000094-M09] - Detection limit for recombinant GST tagged ACVRL1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1E7.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ALK-1 Antibody (1E7.) Summary

Immunogen
ACVRL1 (AAH42637, 22 a.a. - 119 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Specificity
ACVRL1 - activin A receptor type II-like 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACVRL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ALK-1 Antibody (1E7.)

  • activin A receptor type II-like 1
  • activin A receptor, type II-like kinase 1
  • Activin receptor-like kinase 1
  • ACVRL1
  • ACVRLK1ORW2
  • ALK1
  • ALK-1
  • ALK1TGF-B superfamily receptor type I
  • EC 2.7.11
  • HHT
  • HHT2EC 2.7.11.30
  • serine/threonine-protein kinase receptor R3
  • SKR3
  • TSR-I

Background

This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1320
Species: Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF3025
Species: Hu
Applications: WB, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
AF4210
Species: Hu
Applications: WB, IHC
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
H00000094-M09
Species: Hu
Applications: ELISA

Publications for ALK-1 Antibody (H00000094-M09) (0)

There are no publications for ALK-1 Antibody (H00000094-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALK-1 Antibody (H00000094-M09) (0)

There are no reviews for ALK-1 Antibody (H00000094-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ALK-1 Antibody (H00000094-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALK-1 Products

Bioinformatics Tool for ALK-1 Antibody (H00000094-M09)

Discover related pathways, diseases and genes to ALK-1 Antibody (H00000094-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALK-1 Antibody (H00000094-M09)

Discover more about diseases related to ALK-1 Antibody (H00000094-M09).
 

Pathways for ALK-1 Antibody (H00000094-M09)

View related products by pathway.

PTMs for ALK-1 Antibody (H00000094-M09)

Learn more about PTMs related to ALK-1 Antibody (H00000094-M09).
 

Research Areas for ALK-1 Antibody (H00000094-M09)

Find related products by research area.

Blogs on ALK-1

There are no specific blogs for ALK-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALK-1 Antibody (1E7.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACVRL1
Entrez
OMIM
Uniprot