Aldo-keto Reductase 1B10/AKR1B10 Antibody

Images

 
Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody [NBP1-55490] - Titration: 1.25ug/ml Positive Control: A549 cell lysate.

Order Details


    • Catalog Number
      NBP1-55490
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Aldo-keto Reductase 1B10/AKR1B10 Antibody Summary

Immunogen
Synthetic peptides corresponding to AKR1B10(aldo-keto reductase family 1, member B10 (aldose reductase)) The peptide sequence was selected from the N terminal of AKR1B10. Peptide sequence NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL.
Clonality
Polyclonal
Host
Rabbit
Gene
AKR1B10
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against AKR1B10 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Aldo-keto Reductase 1B10/AKR1B10 Antibody

  • AKR1B10
  • AKR1B11
  • AKR1B12
  • Aldo-keto Reductase 1B10
  • aldo-keto reductase family 1 member B10
  • aldo-keto reductase family 1, member B10 (aldose reductase)
  • aldo-keto reductase family 1, member B11 (aldose reductase-like)
  • AldoketoReductase 1B10
  • aldose reductase-like 1
  • aldose reductase-like peptide
  • Aldose reductase-like
  • Aldose reductase-related protein
  • ALDRLn
  • ARL1
  • ARL-1SI reductase
  • ARP
  • EC 1.1.1
  • EC 1.1.1.-
  • EC 1.1.1.21
  • hARP
  • HIS
  • HSI
  • MGC14103
  • Small intestine reductase

Background

AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00000130-M01
Species: Hu
Applications: WB, ELISA
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NB100-2307
Species: Hu
Applications: WB
AF-252-PB
Species: Hu
Applications: WB
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88999
Species: Hu
Applications: IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55490
Species: Hu
Applications: WB

Publications for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490) (0)

There are no publications for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490) (0)

There are no reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aldo-keto Reductase 1B10/AKR1B10 Products

Bioinformatics Tool for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490)

Discover related pathways, diseases and genes to Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490)

Discover more about diseases related to Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490).
 

Pathways for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490)

View related products by pathway.

PTMs for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490)

Learn more about PTMs related to Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490).
 

Research Areas for Aldo-keto Reductase 1B10/AKR1B10 Antibody (NBP1-55490)

Find related products by research area.

Blogs on Aldo-keto Reductase 1B10/AKR1B10

There are no specific blogs for Aldo-keto Reductase 1B10/AKR1B10, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aldo-keto Reductase 1B10/AKR1B10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKR1B10
Entrez
Uniprot