ALDH4A1 Antibody


Western Blot: ALDH4A1 Antibody [NBP1-74242] - Rat Kidney Lysate 1ug/ml Gel Concentration 12%

Product Details

Product Discontinued
View other related ALDH4A1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ALDH4A1 Antibody Summary

Synthetic peptides corresponding to the N terminal of Aldh4a1. Immunizing peptide sequence GSGLRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Aldh4a1 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ALDH4A1 Antibody

  • aldehyde dehydrogenase 4 family, member A1
  • Aldehyde dehydrogenase family 4 member A1
  • ALDH4DKFZp779M035
  • delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
  • EC
  • mitochondrial delta-1-pyrroline 5-carboxylate dehydrogenase
  • P5C dehydrogenase
  • P5CD
  • P5CDH


Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Rt
Applications: WB

Publications for ALDH4A1 Antibody (NBP1-74242) (0)

There are no publications for ALDH4A1 Antibody (NBP1-74242).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH4A1 Antibody (NBP1-74242) (0)

There are no reviews for ALDH4A1 Antibody (NBP1-74242). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALDH4A1 Antibody (NBP1-74242) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALDH4A1 Products

Bioinformatics Tool for ALDH4A1 Antibody (NBP1-74242)

Discover related pathways, diseases and genes to ALDH4A1 Antibody (NBP1-74242). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH4A1 Antibody (NBP1-74242)

Discover more about diseases related to ALDH4A1 Antibody (NBP1-74242).

Pathways for ALDH4A1 Antibody (NBP1-74242)

View related products by pathway.

PTMs for ALDH4A1 Antibody (NBP1-74242)

Learn more about PTMs related to ALDH4A1 Antibody (NBP1-74242).

Blogs on ALDH4A1

There are no specific blogs for ALDH4A1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ALDH4A1 Antibody and receive a gift card or discount.


Gene Symbol ALDH4A1