ALDH1L2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ALDH1L2 Antibody [NBP2-68750] - Staining of human cell line BJ shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ALDH1L2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH1L2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide

Reactivity Notes

Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for ALDH1L2 Antibody

  • aldehyde dehydrogenase 1 family, member L2
  • aldehyde dehydrogenase family 1 member L2
  • DKFZp686A16126
  • DKFZp686M064
  • EC 1.5.1.6
  • FLJ36769
  • FLJ38508
  • MGC119536
  • MGC119537,10-formyltetrahydrofolate dehydrogenase ALDH1L2
  • Mitochondrial 10-formyltetrahydrofolate dehydrogenase
  • mtFDHDKFZp686P14145
  • probable 10-formyltetrahydrofolate dehydrogenase ALDH1L2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50045
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-49350
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89322
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-187
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
NBP2-67132
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56398
Species: Hu
Applications: WB, ICC/IF
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-41176
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86182
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49563
Species: Hu
Applications: WB, IHC, IHC-P
H00001350-P01
Species: Hu
NBP1-92563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
NB100-594
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-13859
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ALDH1L2 Antibody (NBP2-68750) (0)

There are no publications for ALDH1L2 Antibody (NBP2-68750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH1L2 Antibody (NBP2-68750) (0)

There are no reviews for ALDH1L2 Antibody (NBP2-68750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALDH1L2 Antibody (NBP2-68750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALDH1L2 Products

Bioinformatics Tool for ALDH1L2 Antibody (NBP2-68750)

Discover related pathways, diseases and genes to ALDH1L2 Antibody (NBP2-68750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH1L2 Antibody (NBP2-68750)

Discover more about diseases related to ALDH1L2 Antibody (NBP2-68750).
 

Pathways for ALDH1L2 Antibody (NBP2-68750)

View related products by pathway.

Blogs on ALDH1L2

There are no specific blogs for ALDH1L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALDH1L2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH1L2