ALDH1L2 Antibody


Immunocytochemistry/ Immunofluorescence: ALDH1L2 Antibody [NBP1-81935] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALDH1L2 Antibody [NBP1-81935] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ALDH1L2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVP
Specificity of human ALDH1L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ALDH1L2 Antibody

  • aldehyde dehydrogenase 1 family, member L2
  • aldehyde dehydrogenase family 1 member L2
  • DKFZp686A16126
  • DKFZp686M064
  • EC
  • FLJ36769
  • FLJ38508
  • MGC119536
  • MGC119537,10-formyltetrahydrofolate dehydrogenase ALDH1L2
  • Mitochondrial 10-formyltetrahydrofolate dehydrogenase
  • mtFDHDKFZp686P14145
  • probable 10-formyltetrahydrofolate dehydrogenase ALDH1L2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Mk, Sh
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ze
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ALDH1L2 Antibody (NBP1-81935) (0)

There are no publications for ALDH1L2 Antibody (NBP1-81935).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH1L2 Antibody (NBP1-81935) (0)

There are no reviews for ALDH1L2 Antibody (NBP1-81935). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALDH1L2 Antibody (NBP1-81935) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALDH1L2 Products

Bioinformatics Tool for ALDH1L2 Antibody (NBP1-81935)

Discover related pathways, diseases and genes to ALDH1L2 Antibody (NBP1-81935). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH1L2 Antibody (NBP1-81935)

Discover more about diseases related to ALDH1L2 Antibody (NBP1-81935).

Pathways for ALDH1L2 Antibody (NBP1-81935)

View related products by pathway.

Blogs on ALDH1L2

There are no specific blogs for ALDH1L2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ALDH1L2 Antibody and receive a gift card or discount.


Gene Symbol ALDH1L2