ALDH1A3 Antibody


Immunocytochemistry/ Immunofluorescence: ALDH1A3 Antibody [NBP2-56464] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

ALDH1A3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TLAALETMDTGKPFLHAFFIDLEGCIRTLRYF
Specificity of human ALDH1A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 84%, Rat 84%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ALDH1A3 Antibody

  • aldehyde dehydrogenase 1 family, member A3
  • Aldehyde dehydrogenase 6
  • aldehyde dehydrogenase family 1 member A3
  • ALDH1A6
  • ALDH6acetaldehyde dehydrogenase 6
  • EC 1.2.1
  • EC
  • RALDH3
  • RALDH-3
  • Retinaldehyde dehydrogenase 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Fi, Mk, Pm, Sh
Applications: WB, ICC/IF, IHC, IP, ICC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF

Publications for ALDH1A3 Antibody (NBP2-56464) (0)

There are no publications for ALDH1A3 Antibody (NBP2-56464).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH1A3 Antibody (NBP2-56464) (0)

There are no reviews for ALDH1A3 Antibody (NBP2-56464). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ALDH1A3 Antibody (NBP2-56464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALDH1A3 Products

Bioinformatics Tool for ALDH1A3 Antibody (NBP2-56464)

Discover related pathways, diseases and genes to ALDH1A3 Antibody (NBP2-56464). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH1A3 Antibody (NBP2-56464)

Discover more about diseases related to ALDH1A3 Antibody (NBP2-56464).

Pathways for ALDH1A3 Antibody (NBP2-56464)

View related products by pathway.

PTMs for ALDH1A3 Antibody (NBP2-56464)

Learn more about PTMs related to ALDH1A3 Antibody (NBP2-56464).

Research Areas for ALDH1A3 Antibody (NBP2-56464)

Find related products by research area.

Blogs on ALDH1A3

There are no specific blogs for ALDH1A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ALDH1A3 Antibody and receive a gift card or discount.


Gene Symbol ALDH1A3