ALDH1A2 Antibody


Western Blot: ALDH1A2 Antibody [NBP1-69044] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related ALDH1A2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ALDH1A2 Antibody Summary

Synthetic peptides corresponding to ALDH1A2 (aldehyde dehydrogenase 1 family, member A2) The peptide sequence was selected from the N terminal of ALDH1A2. Peptide sequence PVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRL.
Dorso-temporal Retina Marker
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ALDH1A2 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ALDH1A2 Antibody

  • aldehyde dehydrogenase 1 family, member A2
  • Aldehyde dehydrogenase family 1 member A2
  • EC 1.2.1
  • EC
  • RALDH 2
  • RalDH2
  • RALDH2MGC26444
  • RALDH2-T
  • retinal dehydrogenase 2
  • Retinaldehyde-specific dehydrogenase type 2


This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Three transcript variants encoding distinct isoforms have been identified for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF

Publications for ALDH1A2 Antibody (NBP1-69044) (0)

There are no publications for ALDH1A2 Antibody (NBP1-69044).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH1A2 Antibody (NBP1-69044) (0)

There are no reviews for ALDH1A2 Antibody (NBP1-69044). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALDH1A2 Antibody (NBP1-69044) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALDH1A2 Products

Bioinformatics Tool for ALDH1A2 Antibody (NBP1-69044)

Discover related pathways, diseases and genes to ALDH1A2 Antibody (NBP1-69044). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH1A2 Antibody (NBP1-69044)

Discover more about diseases related to ALDH1A2 Antibody (NBP1-69044).

Pathways for ALDH1A2 Antibody (NBP1-69044)

View related products by pathway.

PTMs for ALDH1A2 Antibody (NBP1-69044)

Learn more about PTMs related to ALDH1A2 Antibody (NBP1-69044).

Blogs on ALDH1A2

There are no specific blogs for ALDH1A2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ALDH1A2 Antibody and receive a gift card or discount.


Gene Symbol ALDH1A2