Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody

Images

 
Western Blot: ALDH3A1 Antibody [NBP1-69047] - ALDH3A1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Liver
Immunohistochemistry-Paraffin: ALDH3A1 Antibody [NBP1-69047] - Human Cornea, 1:200 dilution.

Order Details


    • Catalog Number
      NBP1-69047
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ALDH3A1 (aldehyde dehydrogenase 3 family, memberA1) The peptide sequence was selected from the C terminal of ALDH3A1. Peptide sequence KFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRI.
Clonality
Polyclonal
Host
Rabbit
Gene
ALDH3A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ALDH3A1 and was validated on Western blot.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody

  • aldehyde dehydrogenase 3 family, member A1
  • Aldehyde dehydrogenase 3
  • Aldehyde Dehydrogenase 3A1
  • Aldehyde Dehydrogenase 3-A1
  • Aldehyde dehydrogenase family 3 member A1
  • aldehyde dehydrogenase isozyme 3
  • aldehyde dehydrogenase type III
  • ALDH3A1
  • ALDH3aldehyde dehydrogenase, dimeric NADP-preferring
  • ALDHIII
  • EC 1.2.1
  • EC 1.2.1.5
  • MGC10406
  • stomach aldehyde dehydrogenase

Background

Aldehyde dehydrogenases oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The enzyme encoded by this gene forms a cytoplasmic homodimer that preferentially oxidizes aromatic and medium-chain (6 carbons or more) saturated and unsaturated aldehyde substrates. It is thought to promote resistance to UV and 4-hydroxy-2-nonenal-induced oxidative damage in the cornea. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP2-37397
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01017
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
H00000221-D01P
Species: Hu, Mu
Applications: WB
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32569
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84425
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047) (0)

There are no publications for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047) (0)

There are no reviews for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aldehyde Dehydrogenase 3-A1/ALDH3A1 Products

Bioinformatics Tool for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047)

Discover related pathways, diseases and genes to Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047)

Discover more about diseases related to Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047).
 

Pathways for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047)

View related products by pathway.

PTMs for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047)

Learn more about PTMs related to Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047).
 

Research Areas for Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody (NBP1-69047)

Find related products by research area.

Blogs on Aldehyde Dehydrogenase 3-A1/ALDH3A1

There are no specific blogs for Aldehyde Dehydrogenase 3-A1/ALDH3A1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aldehyde Dehydrogenase 3-A1/ALDH3A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH3A1
Entrez
Uniprot