Recombinant Human alcohol dehydrogenase Protein

Images

 

Product Details

Summary
Product Discontinued
View other related alcohol dehydrogenase Peptides and Proteins

Order Details


    • Catalog Number
      H00000124-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human alcohol dehydrogenase Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-78 of Human ADH1A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DSQNLSMNPMLLLTGRTWKGAILGGFKSKECVPKLVADFMAKKFSLDALITHVLPFEKINEGFDLLHSGKSIRTILMF

Protein/Peptide Type
Partial Recombinant Protein
Gene
ADH1A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publications using H00000124-Q01.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human alcohol dehydrogenase Protein

  • ADH, alpha subunit
  • ADH1alcohol dehydrogenase 1A
  • alcohol dehydrogenase 1 (class I), alpha polypeptide
  • alcohol dehydrogenase 1A (class I), alpha polypeptide
  • Alcohol dehydrogenase subunit alpha
  • aldehyde reductase
  • EC 1.1.1
  • EC 1.1.1.1

Background

ADH1A - alcohol dehydrogenase 1A (class I), alpha polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02126
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP1-55039
Species: Hu
Applications: WB
NBP2-02192
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29487
Species: Hu, Mu, Ha, Mk, Pm, Rb
Applications: IHC-P, ICC
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32828
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00000124-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01)(2)

Reviews for alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01) (0)

There are no reviews for alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alcohol dehydrogenase Products

Bioinformatics Tool for alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01)

Discover related pathways, diseases and genes to alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01)

Discover more about diseases related to alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01).
 

Pathways for alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01)

View related products by pathway.

PTMs for alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01)

Learn more about PTMs related to alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01).
 

Research Areas for alcohol dehydrogenase Partial Recombinant Protein (H00000124-Q01)

Find related products by research area.

Blogs on alcohol dehydrogenase

There are no specific blogs for alcohol dehydrogenase, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human alcohol dehydrogenase Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADH1A