AKR1D1 Antibody - BSA Free

Western Blot: AKR1D1 Antibody [NBP2-33811] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Immunohistochemistry-Paraffin: AKR1D1 Antibody [NBP2-33811] - Staining in human liver and kidney tissues using anti-AKR1D1 antibody. Corresponding AKR1D1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AKR1D1 Antibody [NBP2-33811] - Staining of human kidney shows low expression as expected.

Immunohistochemistry-Paraffin: AKR1D1 Antibody [NBP2-33811] - Staining of human liver shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AKR1D1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKR1D1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  AKR1D1 Protein (NBP2-33811PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AKR1D1 Antibody - BSA Free

• 3o5bred
• Aldo-keto reductase family 1 member D1,3-oxo-5-beta-steroid 4-dehydrogenase
• aldo-keto reductase family 1, member D1 (delta4-3-ketosteroid-5-beta-reductase)
• CBAS2
• Delta(4)-3-oxosteroid 5-beta-reductase
• EC 1.3.1.3
• SRD5B1beta polypeptide 1 (3-oxo-5 beta-steroid delta4-dehydrogenase beta 1)

Background

The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKR1D1
• Uniprot:
  • P51857(Human)