Recombinant Human AK2 Protein

Images

 
SDS-Page: Recombinant Human AK2 Protein [H00000204-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AK2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-239 of Human AK2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
AK2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AK2 Protein

  • adenylate kinase 2
  • adenylate kinase 2, mitochondrial
  • adenylate kinase isoenzyme 2, mitochondrial
  • ADK2
  • AK 2
  • ATP-AMP transphosphorylase 2
  • EC 2.7.4
  • EC 2.7.4.3

Background

AK2( AAH09405, 1 a.a. - 240 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00827
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03154
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27173
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-02978
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA

Publications for AK2 Recombinant Protein (H00000204-P01) (0)

There are no publications for AK2 Recombinant Protein (H00000204-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AK2 Recombinant Protein (H00000204-P01) (0)

There are no reviews for AK2 Recombinant Protein (H00000204-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AK2 Recombinant Protein (H00000204-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AK2 Products

Bioinformatics Tool for AK2 Recombinant Protein (H00000204-P01)

Discover related pathways, diseases and genes to AK2 Recombinant Protein (H00000204-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AK2 Recombinant Protein (H00000204-P01)

Discover more about diseases related to AK2 Recombinant Protein (H00000204-P01).
 

Pathways for AK2 Recombinant Protein (H00000204-P01)

View related products by pathway.

PTMs for AK2 Recombinant Protein (H00000204-P01)

Learn more about PTMs related to AK2 Recombinant Protein (H00000204-P01).

Blogs on AK2

There are no specific blogs for AK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AK2 Antibody
NBP1-86043

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AK2