AIP/ARA9 Antibody (3D3)

Images

 
Western Blot: AIP/ARA9 Antibody (3D3) [H00009049-M02] - AIP monoclonal antibody (M02), clone 3D3. Analysis of AIP expression in HepG2.
Sandwich ELISA: AIP/ARA9 Antibody (3D3) [H00009049-M02] - Detection limit for recombinant GST tagged AIP is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

AIP/ARA9 Antibody (3D3) Summary

Immunogen
AIP (NP_003968.1 156 a.a. - 249 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQCKLVVEEYYE
Specificity
aryl hydrocarbon receptor interacting protein
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AIP
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AIP/ARA9 Antibody (3D3)

  • ARA9
  • FKBP16
  • FKBP37
  • SMTPHN
  • XAP2
  • XAP-2

Background

The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-57248
Species: Hu
Applications: WB, ICC/IF
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
H00009049-M02
Species: Hu
Applications: WB, ELISA

Publications for AIP/ARA9 Antibody (H00009049-M02) (0)

There are no publications for AIP/ARA9 Antibody (H00009049-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIP/ARA9 Antibody (H00009049-M02) (0)

There are no reviews for AIP/ARA9 Antibody (H00009049-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AIP/ARA9 Antibody (H00009049-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AIP/ARA9 Products

Bioinformatics Tool for AIP/ARA9 Antibody (H00009049-M02)

Discover related pathways, diseases and genes to AIP/ARA9 Antibody (H00009049-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AIP/ARA9 Antibody (H00009049-M02)

Discover more about diseases related to AIP/ARA9 Antibody (H00009049-M02).
 

Pathways for AIP/ARA9 Antibody (H00009049-M02)

View related products by pathway.

PTMs for AIP/ARA9 Antibody (H00009049-M02)

Learn more about PTMs related to AIP/ARA9 Antibody (H00009049-M02).
 

Research Areas for AIP/ARA9 Antibody (H00009049-M02)

Find related products by research area.

Blogs on AIP/ARA9.

Aryl Hydrocarbon Signaling: AIP, AhR, ARNT, BMAL1 and more...
AH receptor-interacting protein (AIP) is a 37 kD immunophilin-like factor found in a variety of tissues with expression levels ranging from high (spleen, thymus, pituitary heart, placenta and skeletal muscle) to low (liver, kidney and lung). It mediat...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AIP/ARA9 Antibody (3D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol AIP
Entrez
Uniprot