Recombinant Human AIF Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AIF Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-613 of Human AIFM1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
AIFM1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AIF Protein

  • AIF
  • AIFapoptosis-inducing factor 1, mitochondrial
  • AIFM1
  • apoptosis-inducing factor, mitochondrion-associated, 1
  • COXPD6
  • MGC111425
  • PDCD8
  • PDCD8striatal apoptosis-inducing factor
  • programmed cell death 8 (apoptosis-inducing factor)
  • Programmed cell death protein 8

Background

This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Several alternative transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-01696
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00009131-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for AIF Recombinant Protein (H00009131-P01) (0)

There are no publications for AIF Recombinant Protein (H00009131-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIF Recombinant Protein (H00009131-P01) (0)

There are no reviews for AIF Recombinant Protein (H00009131-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AIF Recombinant Protein (H00009131-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AIF Products

Bioinformatics Tool for AIF Recombinant Protein (H00009131-P01)

Discover related pathways, diseases and genes to AIF Recombinant Protein (H00009131-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AIF Recombinant Protein (H00009131-P01)

Discover more about diseases related to AIF Recombinant Protein (H00009131-P01).
 

Pathways for AIF Recombinant Protein (H00009131-P01)

View related products by pathway.

PTMs for AIF Recombinant Protein (H00009131-P01)

Learn more about PTMs related to AIF Recombinant Protein (H00009131-P01).
 

Research Areas for AIF Recombinant Protein (H00009131-P01)

Find related products by research area.

Blogs on AIF

There are no specific blogs for AIF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AIF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AIFM1
Entrez