AIBZIP Antibody (3E3) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related AIBZIP Primary Antibodies

Order Details


    • Catalog Number
      H00148327-M01G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

AIBZIP Antibody (3E3) [DyLight 488] Summary

Immunogen
CREB3L4 (NP_570968, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSP
Specificity
CREB3L4 - cAMP responsive element binding protein 3-like 4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CREB3L4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • RNA Inhibition

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for AIBZIP Antibody (3E3) [DyLight 488]

  • AIbZIP
  • AIBZIPcAMP-responsive element-binding protein 4
  • Androgen-induced basic leucine zipper protein
  • ATCE1JAL
  • Attaching to CRE-like 1
  • cAMP responsive element binding protein 1
  • cAMP responsive element binding protein 3-like 4
  • CREB3
  • CREB4CREB-4
  • cyclic AMP-responsive element-binding protein 3-like protein 4
  • Cyclic AMP-responsive element-binding protein 4
  • hJALcAMP-responsive element-binding protein 3-like protein 4
  • tisp40
  • Transcript induced in spermiogenesis protein 40

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-16008
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82503
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-51927
Species: Hu
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-81760
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-76539
Species: Hu, Mu
Applications: WB, ELISA, ICC
H00000466-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB363
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00148327-M01G
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi

Publications for AIBZIP Antibody (H00148327-M01G) (0)

There are no publications for AIBZIP Antibody (H00148327-M01G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AIBZIP Antibody (H00148327-M01G) (0)

There are no reviews for AIBZIP Antibody (H00148327-M01G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AIBZIP Antibody (H00148327-M01G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AIBZIP Products

Bioinformatics Tool for AIBZIP Antibody (H00148327-M01G)

Discover related pathways, diseases and genes to AIBZIP Antibody (H00148327-M01G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AIBZIP Antibody (H00148327-M01G)

Discover more about diseases related to AIBZIP Antibody (H00148327-M01G).
 

Pathways for AIBZIP Antibody (H00148327-M01G)

View related products by pathway.

PTMs for AIBZIP Antibody (H00148327-M01G)

Learn more about PTMs related to AIBZIP Antibody (H00148327-M01G).
 

Research Areas for AIBZIP Antibody (H00148327-M01G)

Find related products by research area.

Blogs on AIBZIP

There are no specific blogs for AIBZIP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AIBZIP Antibody (3E3) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol CREB3L4