AGXT Antibody

Images

 
Western Blot: AGXT Antibody [NBP1-89200] - Analysis in human liver tissue.
Independent Antibodies: Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human endometrium, fallopian tube, skin and testis using Anti-NEK1 antibody (A) NBP1-89200 shows similar protein ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Analysis in human liver and pancreas tissues. Corresponding AGXT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human liver shows strong granular positivity in cytoplasm in hepatocytes.
Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: AGXT Antibody [NBP1-89200] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Simple Western: AGXT Antibody [NBP1-89200] - Simple Western lane view shows a specific band for AGXT in 0.2 mg/ml of Liver (left), HepG2 (right) lysate. This experiment was performed under reducing conditions using the ...read more
Simple Western: AGXT Antibody [NBP1-89200] - Electropherogram image(s) of corresponding Simple Western lane view. AGXT antibody was used at 1:20 dilution on Liver lysate(s).
Simple Western: AGXT Antibody [NBP1-89200] - Electropherogram image(s) of corresponding Simple Western Lane view. AGXT antibody was used at 1:20 dilution on HepG2 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGXT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGS
Specificity
Specificity of human AGXT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGXT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:20
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. WB reactivity reported in scientific literature (PMID: 26609667).
Control Peptide
AGXT Protein (NBP1-89200PEP)
Publications
Read Publications using
NBP1-89200 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26609667).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AGXT Antibody

  • AGT1L-alanine: glyoxylate aminotransferase 1
  • AGThepatic peroxisomal alanine:glyoxylate aminotransferase
  • AGXT1
  • alanine-glyoxylate aminotransferase
  • Alanine--glyoxylate aminotransferase
  • EC 2.6.1.44
  • EC 2.6.1.51
  • PH1
  • serine:pyruvate aminotransferase
  • SPATserine-pyruvate aminotransferase
  • SPTserine--pyruvate aminotransferase
  • TLH6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-59643
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-86615
Species: Hu
Applications: WB, IHC, IHC-P
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, Gp, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-79775
Species: Hu
Applications: WB, IHC, IHC-P, PA
NBP2-92862
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03348
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-76573
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
NBL1-14964
Species: Hu
NBP1-89200
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P

Publications for AGXT Antibody (NBP1-89200)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for AGXT Antibody (NBP1-89200) (0)

There are no reviews for AGXT Antibody (NBP1-89200). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGXT Antibody (NBP1-89200) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AGXT Products

Bioinformatics Tool for AGXT Antibody (NBP1-89200)

Discover related pathways, diseases and genes to AGXT Antibody (NBP1-89200). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGXT Antibody (NBP1-89200)

Discover more about diseases related to AGXT Antibody (NBP1-89200).
 

Pathways for AGXT Antibody (NBP1-89200)

View related products by pathway.

PTMs for AGXT Antibody (NBP1-89200)

Learn more about PTMs related to AGXT Antibody (NBP1-89200).

Blogs on AGXT

There are no specific blogs for AGXT, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGXT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGXT
Entrez
Uniprot