AGTR-1 Antibody


Immunohistochemistry: AGTR-1 Antibody [NBP1-90212] - Staining of human lung shows strong membranous and cytoplasmic positivity in alveolar cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

AGTR-1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:LQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKP
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AGTR-1 Protein (NBP1-90212PEP)
Read Publication using NBP1-90212.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24303120)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for AGTR-1 Antibody

  • AG2S
  • AGTR1
  • AGTR-1
  • AGTR1AAngiotensin II type-1 receptor
  • AGTR1B
  • angiotensin II receptor, type 1
  • angiotensin receptor 1
  • angiotensin receptor 1B
  • AT1
  • AT1AR
  • AT1AT1AR
  • AT1B
  • AT1BR
  • AT1R
  • AT2R1
  • AT2R1A
  • HAT1R
  • type-1 angiotensin II receptor
  • type-1B angiotensin II receptor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P, IP, PLA
Species: Hu
Applications: WB, Simple Western, IHC, IP
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for AGTR-1 Antibody (NBP1-90212)(1)

Reviews for AGTR-1 Antibody (NBP1-90212) (0)

There are no reviews for AGTR-1 Antibody (NBP1-90212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AGTR-1 Antibody (NBP1-90212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional AGTR-1 Products

Bioinformatics Tool for AGTR-1 Antibody (NBP1-90212)

Discover related pathways, diseases and genes to AGTR-1 Antibody (NBP1-90212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGTR-1 Antibody (NBP1-90212)

Discover more about diseases related to AGTR-1 Antibody (NBP1-90212).

Pathways for AGTR-1 Antibody (NBP1-90212)

View related products by pathway.

PTMs for AGTR-1 Antibody (NBP1-90212)

Learn more about PTMs related to AGTR-1 Antibody (NBP1-90212).

Blogs on AGTR-1

There are no specific blogs for AGTR-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our AGTR-1 Antibody and receive a gift card or discount.


Gene Symbol AGTR1