AGPAT6 Recombinant Protein Antigen

Images

 
There are currently no images for AGPAT6 Protein (NBP1-85061PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AGPAT6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGPAT6.

Source: E. coli

Amino Acid Sequence: FAWATLRMERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCRKGMETIMDDEVTKRFSAEELESW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AGPAT6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85061.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for AGPAT6 Recombinant Protein Antigen

  • 1-acylglycerol-3-phosphate O-acyltransferase 6 (lysophosphatidic acidacyltransferase, zeta)
  • Acyl-CoA:glycerol-3-phosphate acyltransferase 4
  • DKFZp586M1819,1-acyl-sn-glycerol-3-phosphate acyltransferase zeta
  • EC 2.3.1.15
  • glycerol-3-phosphate acyltransferase 4,1-AGP acyltransferase 6
  • glycerol-3-phosphate acyltransferase 6,1-AGPAT 6
  • GPAT4,1-acylglycerol-3-phosphate O-acyltransferase 6
  • LPAAT-zetaLPAATZ
  • Lysophosphatidic acid acyltransferase zeta
  • testis spermatogenesis apoptosis-related protein 7
  • TSARG7

Background

Glycerol-3-phosphate acyltransferase 4 (GPAT4), also known as AGPAT6, is a novel glycerolipid acyltransferase of the ER, which is crucial for the production of milk fat by the mammary gland.

Agpat6 deficiency leads to a reduction in body weight and resistance to both diet-induced and genetically induced obesity. This reduced body weight is associated with increased energy expenditure, reduced triglyceride accumulation in BAT and WAT, reduced white adipocyte size, and lack of adipose tissue in the subdermal region. AGPAT6 fills a unique role in determining triglyceride content and composition in adipose tissue and liver that cannot be compensated by other members of the Agpat family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76907
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-02056
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NB110-41487
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
AF7550
Species: Hu
Applications: KO, WB
NB110-57150
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP3-15744
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-19860
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
AF6868
Species: Hu
Applications: IHC, KO, WB
NBP1-90276
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37477
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB400-144
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB1678
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP3-05516
Species: Hu
Applications: IHC, IHC-P

Publications for AGPAT6 Protein (NBP1-85061PEP) (0)

There are no publications for AGPAT6 Protein (NBP1-85061PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGPAT6 Protein (NBP1-85061PEP) (0)

There are no reviews for AGPAT6 Protein (NBP1-85061PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AGPAT6 Protein (NBP1-85061PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AGPAT6 Products

Bioinformatics Tool for AGPAT6 Protein (NBP1-85061PEP)

Discover related pathways, diseases and genes to AGPAT6 Protein (NBP1-85061PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGPAT6 Protein (NBP1-85061PEP)

Discover more about diseases related to AGPAT6 Protein (NBP1-85061PEP).
 

Pathways for AGPAT6 Protein (NBP1-85061PEP)

View related products by pathway.

PTMs for AGPAT6 Protein (NBP1-85061PEP)

Learn more about PTMs related to AGPAT6 Protein (NBP1-85061PEP).
 

Research Areas for AGPAT6 Protein (NBP1-85061PEP)

Find related products by research area.

Blogs on AGPAT6

There are no specific blogs for AGPAT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AGPAT6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AGPAT6