Aggrecan Antibody (2A8) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Aggrecan Primary Antibodies

Order Details


    • Catalog Number
      H00000176-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Aggrecan Antibody (2A8) [PerCP] Summary

Immunogen
AGC1 (NP_037359, 56 a.a. - 155 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMHPVTTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVF
Marker
Chondrocyte Marker
Specificity
AGC1 - aggrecan 1 (chondroitin sulfate proteoglycan 1, large aggregating proteoglycan, antigen identified by monoclonal A0122)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACAN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aggrecan Antibody (2A8) [PerCP]

  • ACAN
  • AGC1
  • AGC1SEDK
  • aggrecan core protein
  • Aggrecan
  • Cartilage-specific proteoglycan core protein
  • Chondroitin sulfate proteoglycan 1
  • Chondroitin sulfate proteoglycan core protein 1
  • CSPCP
  • CSPG1
  • CSPG1aggrecan 1
  • CSPGCP
  • large aggregating proteoglycan
  • MSK16
  • MSK16AGCAN
  • SEDK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3075
Species: Hu
Applications: WB, ICC
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
355-BM/CF
Species: Hu, Mu, Rt
NBP1-89246
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5465
Species: Hu
Applications: WB, IP
H00000176-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Aggrecan Antibody (H00000176-M01PCP) (0)

There are no publications for Aggrecan Antibody (H00000176-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aggrecan Antibody (H00000176-M01PCP) (0)

There are no reviews for Aggrecan Antibody (H00000176-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aggrecan Antibody (H00000176-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aggrecan Products

Bioinformatics Tool for Aggrecan Antibody (H00000176-M01PCP)

Discover related pathways, diseases and genes to Aggrecan Antibody (H00000176-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aggrecan Antibody (H00000176-M01PCP)

Discover more about diseases related to Aggrecan Antibody (H00000176-M01PCP).
 

Pathways for Aggrecan Antibody (H00000176-M01PCP)

View related products by pathway.

PTMs for Aggrecan Antibody (H00000176-M01PCP)

Learn more about PTMs related to Aggrecan Antibody (H00000176-M01PCP).
 

Research Areas for Aggrecan Antibody (H00000176-M01PCP)

Find related products by research area.

Blogs on Aggrecan.

Aches & Pains: Aggrecan in Joint Disease and Osteoarthritis
Aggrecan is essential for the normal function of articular cartilage and intervertebral discs. Aggrecan provides the ability for the tissues to withstand compressive loading. This property is dependent on both the high charge density endowed by its nu...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aggrecan Antibody (2A8) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAN
Entrez