AFTPH Antibody

Images

 
Western Blot: AFTPH Antibody [NBP2-38227] - Analysis in control (vector only transfected HEK293T lysate) and AFTPH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: AFTPH Antibody [NBP2-38227] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol, the Golgi apparatus & vesicles.
Immunohistochemistry-Paraffin: AFTPH Antibody [NBP2-38227] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AFTPH Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DSVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AFTPH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AFTPH Protein (NBP2-38227PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AFTPH Antibody

  • AFTH
  • aftiphilin protein
  • aftiphilin
  • FLJ20080
  • FLJ23793
  • MGC33965
  • Nbla10388

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NBP2-67710
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90145
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-586
Species: Hu, Mu, Ca, Fe
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC
NB300-653
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89060
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00009685-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43567
Species: Hu, Mu
Applications: WB, ICC/IF, KO
H00004218-M02
Species: Hu, Mu, Ze
Applications: WB, ELISA, ICC/IF
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
NBP1-88829
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AFTPH Antibody (NBP2-38227) (0)

There are no publications for AFTPH Antibody (NBP2-38227).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AFTPH Antibody (NBP2-38227) (0)

There are no reviews for AFTPH Antibody (NBP2-38227). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AFTPH Antibody (NBP2-38227) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AFTPH Products

Bioinformatics Tool for AFTPH Antibody (NBP2-38227)

Discover related pathways, diseases and genes to AFTPH Antibody (NBP2-38227). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AFTPH Antibody (NBP2-38227)

Discover more about diseases related to AFTPH Antibody (NBP2-38227).
 

Pathways for AFTPH Antibody (NBP2-38227)

View related products by pathway.

Blogs on AFTPH

There are no specific blogs for AFTPH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AFTPH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AFTPH
Uniprot