AF4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AF4 Antibody [NBP2-56873] - Staining of human cell line SiHa shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AF4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSK
Specificity
Specificity of human AF4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AFF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AF4 Recombinant Protein Antigen (NBP2-56873PEP)

Reactivity Notes

Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for AF4 Antibody

  • AF-4
  • AF4/FMR2 family member 1
  • AF4/FMR2 family, member 1
  • AF4myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 2
  • ALL1-fused gene from chromosome 4 protein
  • FEL
  • MLLT2MGC134969
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 2
  • PBM1
  • pre-B-cell monocytic leukemia partner 1
  • Protein AF-4
  • Protein FEL
  • Proto-oncogene AF4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90217
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-87714
Species: Hu
Applications: IHC, IHC-P
NBP2-84403
Species: Hu
Applications: WB
H00004298-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
AF5129
Species: Hu
Applications: WB
NBP1-62489
Species: Hu, Mu, Dr
Applications: WB
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027125-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-82991
Species: Hu
Applications: WB, IHC, IHC-P
AF7829
Species: Hu
Applications: WB, IHC, ICC
NBP1-90222
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
H00005087-M01
Species: Hu, Mu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-67717
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready

Publications for AF4 Antibody (NBP2-56873) (0)

There are no publications for AF4 Antibody (NBP2-56873).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AF4 Antibody (NBP2-56873) (0)

There are no reviews for AF4 Antibody (NBP2-56873). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AF4 Antibody (NBP2-56873) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AF4 Products

Array NBP2-56873

Bioinformatics Tool for AF4 Antibody (NBP2-56873)

Discover related pathways, diseases and genes to AF4 Antibody (NBP2-56873). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AF4 Antibody (NBP2-56873)

Discover more about diseases related to AF4 Antibody (NBP2-56873).
 

Pathways for AF4 Antibody (NBP2-56873)

View related products by pathway.

PTMs for AF4 Antibody (NBP2-56873)

Learn more about PTMs related to AF4 Antibody (NBP2-56873).

Blogs on AF4

There are no specific blogs for AF4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AFF1