AE Binding Protein 1/ACLP Antibody - BSA Free

Immunohistochemistry-Paraffin: AE Binding Protein 1/ACLP Antibody [NBP2-49432] - Staining in human seminal vesicle and liver tissues using anti-AEBP1 antibody. Corresponding AEBP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AE Binding Protein 1/ACLP Antibody [NBP2-49432] - Staining of human seminal vesicle shows high expression.

Immunohistochemistry-Paraffin: AE Binding Protein 1/ACLP Antibody [NBP2-49432] - Staining of human liver shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AE Binding Protein 1/ACLP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEKGKDH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AEBP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  AE Binding Protein 1/ACLP Recombinant Protein Antigen (NBP2-49432PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AE Binding Protein 1/ACLP Antibody - BSA Free

• ACLP
• ACLPadipocyte enhancer binding protein 1
• AE binding protein 1
• AE-binding protein 1adipocyte enhancer-binding protein 1
• AEBP1
• Aortic carboxypeptidase-like protein
• FLJ33612

Background

The adipocyte enhancer binding protein 1 is a transcriptional repressor with carboxypeptidase (CP) activity. This protein binds to a regulatory sequence, adipocyte enhancer 1 (AE-1), located in the proximal promoter region of the adipose P2 (aP2) gene, which encodes the adipocyte fatty-acid binding protein. It is characterized as a member of the regulatory B-like CP family. This protein seems to be activated by a novel mechanism, whereby the direct binding of DNA enhances its protease activity. Adipocyte-enhancer binding protein 1 may play a role in differentiated vascular smooth muscle cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AEBP1