Adiponectin/Acrp30 Recombinant Protein Antigen

Images

 
There are currently no images for Adiponectin/Acrp30 Protein (NBP2-38657PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Adiponectin/Acrp30 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADIPOQ.

Source: E. coli

Amino Acid Sequence: YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADIPOQ
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38657.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Adiponectin/Acrp30 Recombinant Protein Antigen

  • ACDC
  • Acrp30
  • ACRP30ADPN
  • adipocyte, C1Q and collagen domain containing
  • Adiponectin
  • adiponectin, C1Q and collagen domain containing
  • AdipoQ
  • ADIPQTL1
  • ApM1
  • apM-1
  • APM1APM-1
  • C1q and collagen domain-containing protein
  • GBP28
  • GBP28apM1
  • Gelatin-binding protein

Background

Adipose cells produce and secrete numerous physiologically important proteins, such as Lipoprotein Lipase, Leptin, and Adipocyte Complement Related protein of 30 kDa, also known as Acrp30 or Adiponectin. Adiponectin is a circulating protein that is secreted exclusively by differentiated adipocytes. During adipocyte differentiation, Adiponectin mRNA is induced >100 fold. Adiponectin improves the ability of insulin to suppress glucose production, at sub physiological levels, thereby linking adipose tissue to whole body glucose regulation. Adiponectin function appears to be regulated by phosphatidylinositol 3 kinase (PI3K) since Adiponectin secretion is blocked by pharmacologic inhibitors of this kinase. Adiponectin mRNA is significantly reduced in adipose tissue of obese patients with Type 2 diabetes. The structural similarity of Adiponectin to TNF alpha suggests that Adiponectin may play a role in pathogenesis of insulin resistance in Type 2 diabetes. Adiponectin is implicated as a regulator of whole body energy homeostasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DLP00
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
DY1707
Species: Hu
Applications: ELISA
DRSN00
Species: Hu
Applications: ELISA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67631
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-28641
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, PA, Simple Western, WB
NB100-594
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-19773
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-22127
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF2850
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AF2854
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB8200
Species: Hu, Mu
Applications: IHC
291-G1
Species: Hu
Applications: BA
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P

Publications for Adiponectin/Acrp30 Protein (NBP2-38657PEP) (0)

There are no publications for Adiponectin/Acrp30 Protein (NBP2-38657PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adiponectin/Acrp30 Protein (NBP2-38657PEP) (0)

There are no reviews for Adiponectin/Acrp30 Protein (NBP2-38657PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Adiponectin/Acrp30 Protein (NBP2-38657PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Adiponectin/Acrp30 Products

Research Areas for Adiponectin/Acrp30 Protein (NBP2-38657PEP)

Find related products by research area.

Blogs on Adiponectin/Acrp30

There are no specific blogs for Adiponectin/Acrp30, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Adiponectin/Acrp30 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADIPOQ