Adiponectin/Acrp30 Antibody - BSA Free

Western Blot: Adiponectin/Acrp30 Antibody [NBP2-38657] -Analysis in human breast tissue.

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] -Staining of human skeletal muscle shows strong membranous positivity in myocytes.

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] - Staining of human endometrium shows strong membranous positivity in cells in endometrial stroma.

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] - Staining of human skin shows strong membranous positivity in basal squamous epithelial cells.

Immunohistochemistry-Paraffin: Adiponectin/Acrp30 Antibody [NBP2-38657] -Staining of human kidney shows strong membranous positivity in cells in glomeruli.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Adiponectin/Acrp30 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Adiponectin/Acrp30 Antibody - BSA Free (NBP2-38657) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADIPOQ
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Adiponectin/Acrp30 Protein (NBP2-38657PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Adiponectin/Acrp30 Antibody - BSA Free

• ACDC
• Acrp30
• ACRP30ADPN
• adipocyte, C1Q and collagen domain containing
• Adiponectin
• adiponectin, C1Q and collagen domain containing
• AdipoQ
• ADIPQTL1
• ApM1
• apM-1
• APM1APM-1
• C1q and collagen domain-containing protein
• GBP28
• GBP28apM1
• Gelatin-binding protein

Background

Adipose cells produce and secrete numerous physiologically important proteins, such as Lipoprotein Lipase, Leptin, and Adipocyte Complement Related protein of 30 kDa, also known as Acrp30 or Adiponectin. Adiponectin is a circulating protein that is secreted exclusively by differentiated adipocytes. During adipocyte differentiation, Adiponectin mRNA is induced >100 fold. Adiponectin improves the ability of insulin to suppress glucose production, at sub physiological levels, thereby linking adipose tissue to whole body glucose regulation. Adiponectin function appears to be regulated by phosphatidylinositol 3 kinase (PI3K) since Adiponectin secretion is blocked by pharmacologic inhibitors of this kinase. Adiponectin mRNA is significantly reduced in adipose tissue of obese patients with Type 2 diabetes. The structural similarity of Adiponectin to TNF alpha suggests that Adiponectin may play a role in pathogenesis of insulin resistance in Type 2 diabetes. Adiponectin is implicated as a regulator of whole body energy homeostasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADIPOQ
• Uniprot:
  • Q15848()