Adiponectin/Acrp30 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Adiponectin/Acrp30 Antibody - BSA Free (NBP2-38657) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL |
| Predicted Species |
Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ADIPOQ |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Adiponectin/Acrp30 Antibody - BSA Free
Background
Adipose cells produce and secrete numerous physiologically important proteins, such as Lipoprotein Lipase, Leptin, and Adipocyte Complement Related protein of 30 kDa, also known as Acrp30 or Adiponectin. Adiponectin is a circulating protein that is secreted exclusively by differentiated adipocytes. During adipocyte differentiation, Adiponectin mRNA is induced >100 fold. Adiponectin improves the ability of insulin to suppress glucose production, at sub physiological levels, thereby linking adipose tissue to whole body glucose regulation. Adiponectin function appears to be regulated by phosphatidylinositol 3 kinase (PI3K) since Adiponectin secretion is blocked by pharmacologic inhibitors of this kinase. Adiponectin mRNA is significantly reduced in adipose tissue of obese patients with Type 2 diabetes. The structural similarity of Adiponectin to TNF alpha suggests that Adiponectin may play a role in pathogenesis of insulin resistance in Type 2 diabetes. Adiponectin is implicated as a regulator of whole body energy homeostasis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, PA, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: BA
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Publications for Adiponectin/Acrp30 Antibody (NBP2-38657) (0)
There are no publications for Adiponectin/Acrp30 Antibody (NBP2-38657).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Adiponectin/Acrp30 Antibody (NBP2-38657) (0)
There are no reviews for Adiponectin/Acrp30 Antibody (NBP2-38657).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Adiponectin/Acrp30 Antibody (NBP2-38657) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Adiponectin/Acrp30 Products
Research Areas for Adiponectin/Acrp30 Antibody (NBP2-38657)
Find related products by research area.
|
Blogs on Adiponectin/Acrp30