Adenylosuccinate Lyase Antibody

Images

 
Western Blot: Adenylosuccinate Lyase Antibody [NBP1-68950] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Immunohistochemistry: Adenylosuccinate Lyase Antibody [NBP1-68950] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic in endothelial cells in blood vessels Primary Antibody ...read more
Western Blot: Adenylosuccinate Lyase Antibody [NBP1-68950] - Sample Type: 1. Hamster CHO K1 cells (20ug) 2. HeLa skin cells(100ug) 3. HEK273 cells (100ug) 4. HepG2 cells (100ug) 5. purified human ADSL protein (40ng) ...read more
Western Blot: Adenylosuccinate Lyase Antibody [NBP1-68950] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Summary
Product Discontinued
View other related Adenylosuccinate Lyase Primary Antibodies

Order Details


    • Catalog Number
      NBP1-68950
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Adenylosuccinate Lyase Antibody Summary

Immunogen
Synthetic peptides corresponding to ADSL (adenylosuccinate lyase) The peptide sequence was selected from the middle region of ADSL. Peptide sequence RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI.
Clonality
Polyclonal
Host
Rabbit
Gene
ADSL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against ADSL and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Adenylosuccinate Lyase Antibody

  • adenylosuccinase
  • adenylosuccinate lyase
  • AMPS
  • ASase
  • ASL
  • EC 4.3.2
  • EC 4.3.2.2

Background

Adenylsuccinate lyase is involved in both de novo synthesis of purines and formation of adenosine monophosphate from inosine monophosphate. It catalyzes two reactions in AMP biosynthesis: the removal of a fumarate from succinylaminoimidazole carboxamide (SAICA) ribotide to give aminoimidazole carboxamide ribotide (AICA) and removal of fumarate from adenylosuccinate to give AMP. Adenylosuccinase deficiency results in succinylpurinemic autism, psychomotor retardation, and, in some cases, growth retardation associated with muscle wasting and epilepsy. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68950
Species: Hu
Applications: WB, IHC

Publications for Adenylosuccinate Lyase Antibody (NBP1-68950) (0)

There are no publications for Adenylosuccinate Lyase Antibody (NBP1-68950).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylosuccinate Lyase Antibody (NBP1-68950) (0)

There are no reviews for Adenylosuccinate Lyase Antibody (NBP1-68950). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenylosuccinate Lyase Antibody (NBP1-68950) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenylosuccinate Lyase Products

Bioinformatics Tool for Adenylosuccinate Lyase Antibody (NBP1-68950)

Discover related pathways, diseases and genes to Adenylosuccinate Lyase Antibody (NBP1-68950). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylosuccinate Lyase Antibody (NBP1-68950)

Discover more about diseases related to Adenylosuccinate Lyase Antibody (NBP1-68950).
 

Pathways for Adenylosuccinate Lyase Antibody (NBP1-68950)

View related products by pathway.

PTMs for Adenylosuccinate Lyase Antibody (NBP1-68950)

Learn more about PTMs related to Adenylosuccinate Lyase Antibody (NBP1-68950).
 

Research Areas for Adenylosuccinate Lyase Antibody (NBP1-68950)

Find related products by research area.

Blogs on Adenylosuccinate Lyase

There are no specific blogs for Adenylosuccinate Lyase, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenylosuccinate Lyase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADSL
Uniprot