Recombinant Human Adenylate Kinase 1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Adenylate Kinase 1 Peptides and Proteins

Order Details


    • Catalog Number
      H00000203-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Adenylate Kinase 1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-194 of Human AK1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK

Protein/Peptide Type
Recombinant Protein
Gene
AK1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Adenylate Kinase 1 Protein

  • adenylate kinase 1
  • adenylate kinase isoenzyme 1
  • AK 1
  • ATP-AMP transphosphorylase 1
  • EC 2.7.4
  • EC 2.7.4.3
  • myokinase

Background

AK1( AAH01116, 1 a.a. - 195 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86043
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5075
Species: Hu, Mu, Rt
Applications: WB
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-00827
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP2-03154
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-32601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30375
Species: Hu
Applications: IHC, IHC-P

Publications for Adenylate Kinase 1 Recombinant Protein (H00000203-P01) (0)

There are no publications for Adenylate Kinase 1 Recombinant Protein (H00000203-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylate Kinase 1 Recombinant Protein (H00000203-P01) (0)

There are no reviews for Adenylate Kinase 1 Recombinant Protein (H00000203-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenylate Kinase 1 Recombinant Protein (H00000203-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Adenylate Kinase 1 Products

Bioinformatics Tool for Adenylate Kinase 1 Recombinant Protein (H00000203-P01)

Discover related pathways, diseases and genes to Adenylate Kinase 1 Recombinant Protein (H00000203-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylate Kinase 1 Recombinant Protein (H00000203-P01)

Discover more about diseases related to Adenylate Kinase 1 Recombinant Protein (H00000203-P01).
 

Pathways for Adenylate Kinase 1 Recombinant Protein (H00000203-P01)

View related products by pathway.

PTMs for Adenylate Kinase 1 Recombinant Protein (H00000203-P01)

Learn more about PTMs related to Adenylate Kinase 1 Recombinant Protein (H00000203-P01).

Blogs on Adenylate Kinase 1

There are no specific blogs for Adenylate Kinase 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Adenylate Kinase 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AK1