Adenylate Kinase 1 Antibody

Images

 
Western Blot: Adenylate Kinase 1 Antibody [NBP1-54637] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Adenylate Kinase 1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54637
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Adenylate Kinase 1 Antibody Summary

Immunogen
Synthetic peptides corresponding to AK1(adenylate kinase 1) The peptide sequence was selected from the middle region of AK1. Peptide sequence RIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKAT.
Clonality
Polyclonal
Host
Rabbit
Gene
AK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against AK1 and was validated on Western blot.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Adenylate Kinase 1 Antibody

  • adenylate kinase 1
  • adenylate kinase isoenzyme 1
  • AK 1
  • ATP-AMP transphosphorylase 1
  • EC 2.7.4
  • EC 2.7.4.3
  • myokinase

Background

Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86043
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5075
Species: Hu, Mu, Rt
Applications: WB
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-00827
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP2-03154
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-32601
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30375
Species: Hu
Applications: IHC, IHC-P

Publications for Adenylate Kinase 1 Antibody (NBP1-54637) (0)

There are no publications for Adenylate Kinase 1 Antibody (NBP1-54637).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylate Kinase 1 Antibody (NBP1-54637) (0)

There are no reviews for Adenylate Kinase 1 Antibody (NBP1-54637). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenylate Kinase 1 Antibody (NBP1-54637) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenylate Kinase 1 Products

Bioinformatics Tool for Adenylate Kinase 1 Antibody (NBP1-54637)

Discover related pathways, diseases and genes to Adenylate Kinase 1 Antibody (NBP1-54637). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylate Kinase 1 Antibody (NBP1-54637)

Discover more about diseases related to Adenylate Kinase 1 Antibody (NBP1-54637).
 

Pathways for Adenylate Kinase 1 Antibody (NBP1-54637)

View related products by pathway.

PTMs for Adenylate Kinase 1 Antibody (NBP1-54637)

Learn more about PTMs related to Adenylate Kinase 1 Antibody (NBP1-54637).

Blogs on Adenylate Kinase 1

There are no specific blogs for Adenylate Kinase 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenylate Kinase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AK1
Uniprot