Recombinant Human Adenylate Cyclase 8 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Adenylate Cyclase 8 Protein [H00000114-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Adenylate Cyclase 8 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1142-1251 of Human Adenylate Cyclase 8

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADCY8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Adenylate Cyclase 8 GST (N-Term) Protein

  • AC8
  • ADCY3
  • adenylate cyclase 8 (brain)
  • adenylate cyclase type 8
  • Adenylate cyclase type VIII
  • Adenylyl cyclase 8
  • adenylyl cyclase-8, brain
  • ATP pyrophosphate-lyase 8
  • Ca(2+)/calmodulin-activated adenylyl cyclase
  • EC 4.6.1.1
  • HBAC1

Background

ADCY8 - adenylate cyclase 8 (brain)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92583
Species: Hu, Mu
Applications: WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
H00010141-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-14871
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
H00000111-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-59023
Species: Hu
Applications: WB
NBP1-33659
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-90364
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-30380
Species: Hu
Applications: IHC, IHC-P
NBP2-14268
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Bv, Hu, Mu, Po, Rb
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38713
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-82567
Species: Hu
Applications: WB
NB100-56708
Species: Ch, ChHa, Hu, Ma, Mu, Po, Rt
Applications: CyTOF-ready, EM, Flow, HEStain, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, KD, KO, Simple Western, WB
640-A3
Species: Mu
Applications: Bind
NBP2-89114
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01) (0)

There are no publications for Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01) (0)

There are no reviews for Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Adenylate Cyclase 8 Products

Bioinformatics Tool for Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01)

Discover related pathways, diseases and genes to Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01)

Discover more about diseases related to Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01).
 

Pathways for Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01)

View related products by pathway.

PTMs for Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01)

Learn more about PTMs related to Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01).
 

Research Areas for Adenylate Cyclase 8 Partial Recombinant Protein (H00000114-Q01)

Find related products by research area.

Blogs on Adenylate Cyclase 8

There are no specific blogs for Adenylate Cyclase 8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Adenylate Cyclase 8 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADCY8