Recombinant Human Adenosine A2a R Protein

Images

 
SDS-Page: Recombinant Human Adenosine A2a R Protein [H00000135-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

Recombinant Human Adenosine A2a R Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-121 of Human ADORA2A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADORA2A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Adenosine A2a R Protein

  • A2aR
  • adenosine A2 receptor
  • Adenosine A2a R
  • adenosine A2a receptor
  • Adenosine A2aR
  • adenosine receptor A2a
  • adenosine receptor subtype A2a
  • ADORA 2
  • ADORA2
  • ADORA2A
  • hA2aR
  • RDC8

Background

This gene encodes a protein which is one of several receptor subtypes for adenosine. The activity of the encoded protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. The encoded protein is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-549
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-41312
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Adenosine A2a R Partial Recombinant Protein (H00000135-Q01) (0)

There are no publications for Adenosine A2a R Partial Recombinant Protein (H00000135-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenosine A2a R Partial Recombinant Protein (H00000135-Q01) (0)

There are no reviews for Adenosine A2a R Partial Recombinant Protein (H00000135-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenosine A2a R Partial Recombinant Protein (H00000135-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Adenosine A2a R Products

Bioinformatics Tool for Adenosine A2a R Partial Recombinant Protein (H00000135-Q01)

Discover related pathways, diseases and genes to Adenosine A2a R Partial Recombinant Protein (H00000135-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenosine A2a R Partial Recombinant Protein (H00000135-Q01)

Discover more about diseases related to Adenosine A2a R Partial Recombinant Protein (H00000135-Q01).
 

Pathways for Adenosine A2a R Partial Recombinant Protein (H00000135-Q01)

View related products by pathway.

PTMs for Adenosine A2a R Partial Recombinant Protein (H00000135-Q01)

Learn more about PTMs related to Adenosine A2a R Partial Recombinant Protein (H00000135-Q01).
 

Research Areas for Adenosine A2a R Partial Recombinant Protein (H00000135-Q01)

Find related products by research area.

Blogs on Adenosine A2a R

There are no specific blogs for Adenosine A2a R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Adenosine A2a R Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADORA2A
Entrez