Adenosine A2a R Antibody

Images

 
Western Blot: Adenosine A2a R Antibody [H00000135-B01P] - Analysis of ADORA2A expression in HeLa.
Flow Cytometry: Adenosine A2a R Antibody [H00000135-B01P] - Analysis of negative control 293 cells (Black) and ADORA2A expressing 293 cells (Green) using ADORA2A purified mouse polyclonal antibody.
Western Blot: Adenosine A2a R Antibody [H00000135-B01P] - Analysis of ADORA2A expression in transfected 293T cell line by ADORA2A polyclonal antibody. Lane 1: ADORA2A transfected lysate(45.43 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Adenosine A2a R Antibody Summary

Immunogen
ADORA2A (AAH13780.1, 1 a.a. - 412 a.a.) full-length human protein. MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ADORA2A
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Flow Cytometry
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Adenosine A2a R Antibody

  • A2aR
  • adenosine A2 receptor
  • Adenosine A2a R
  • adenosine A2a receptor
  • Adenosine A2aR
  • adenosine receptor A2a
  • adenosine receptor subtype A2a
  • ADORA 2
  • ADORA2
  • ADORA2A
  • hA2aR
  • RDC8

Background

This gene encodes a protein which is one of several receptor subtypes for adenosine. The activity of the encoded protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. The encoded protein is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-549
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-41312
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Adenosine A2a R Antibody (H00000135-B01P) (0)

There are no publications for Adenosine A2a R Antibody (H00000135-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenosine A2a R Antibody (H00000135-B01P) (0)

There are no reviews for Adenosine A2a R Antibody (H00000135-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenosine A2a R Antibody (H00000135-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenosine A2a R Products

Bioinformatics Tool for Adenosine A2a R Antibody (H00000135-B01P)

Discover related pathways, diseases and genes to Adenosine A2a R Antibody (H00000135-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenosine A2a R Antibody (H00000135-B01P)

Discover more about diseases related to Adenosine A2a R Antibody (H00000135-B01P).
 

Pathways for Adenosine A2a R Antibody (H00000135-B01P)

View related products by pathway.

PTMs for Adenosine A2a R Antibody (H00000135-B01P)

Learn more about PTMs related to Adenosine A2a R Antibody (H00000135-B01P).
 

Research Areas for Adenosine A2a R Antibody (H00000135-B01P)

Find related products by research area.

Blogs on Adenosine A2a R

There are no specific blogs for Adenosine A2a R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenosine A2a R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADORA2A
Entrez
Uniprot