Recombinant Human ADAMTS13 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ADAMTS13 Peptides and Proteins

Order Details


    • Catalog Number
      H00011093-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ADAMTS13 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1328-1427 of Human ADAMTS13 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADAMTS13

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
2.5% glycine, 0.5% sucrose, 0.01% Tween 80, 5 mM Glutamic acid, pH 4.5

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADAMTS13 Protein

  • A disintegrin and metalloproteinase with thrombospondin motifs 13
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 13
  • ADAM metallopeptidase with thrombospondin type 1 motif, 13
  • ADAMTS13
  • ADAM-TS13
  • ADAMTS-13
  • DKFZp434C2322
  • EC 3.4.24.14
  • EC 3.4.24.82
  • EC 3.4.24.87
  • FLJ42993
  • MGC118899
  • MGC118900
  • TTP
  • TTPADAM-TS 13
  • vWF-cleaving protease
  • vWF-CP
  • vWF-CPC9orf8
  • VWFCPvon Willebrand factor-cleaving protease

Background

ADAMTS13 - a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00011093-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ADAMTS13 Partial Recombinant Protein (H00011093-Q01) (0)

There are no publications for ADAMTS13 Partial Recombinant Protein (H00011093-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS13 Partial Recombinant Protein (H00011093-Q01) (0)

There are no reviews for ADAMTS13 Partial Recombinant Protein (H00011093-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAMTS13 Partial Recombinant Protein (H00011093-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAMTS13 Products

Bioinformatics Tool for ADAMTS13 Partial Recombinant Protein (H00011093-Q01)

Discover related pathways, diseases and genes to ADAMTS13 Partial Recombinant Protein (H00011093-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTS13 Partial Recombinant Protein (H00011093-Q01)

Discover more about diseases related to ADAMTS13 Partial Recombinant Protein (H00011093-Q01).
 

Pathways for ADAMTS13 Partial Recombinant Protein (H00011093-Q01)

View related products by pathway.

PTMs for ADAMTS13 Partial Recombinant Protein (H00011093-Q01)

Learn more about PTMs related to ADAMTS13 Partial Recombinant Protein (H00011093-Q01).
 

Research Areas for ADAMTS13 Partial Recombinant Protein (H00011093-Q01)

Find related products by research area.

Blogs on ADAMTS13

There are no specific blogs for ADAMTS13, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADAMTS13 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS13
Entrez