Recombinant Human ADAM9 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ADAM9 Peptides and Proteins

Order Details


    • Catalog Number
      H00008754-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ADAM9 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 36-135 of Human ADAM9 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFG

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADAM9

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADAM9 Protein

  • a disintegrin and metalloproteinase domain 9 (meltrin gamma)
  • ADAM 9
  • ADAM metallopeptidase domain 9 (meltrin gamma)
  • ADAM metallopeptidase domain 9
  • ADAM9
  • Cellular disintegrin-related protein
  • cone rod dystrophy 9
  • CORD9
  • disintegrin and metalloproteinase domain-containing protein 9
  • EC 3.4.24
  • EC 3.4.24.-
  • MCMP
  • MCMPMDC9KIAA0021Mltng
  • MDC9
  • Meltrin gamma
  • Meltrin-gamma
  • Metalloprotease/disintegrin/cysteine-rich protein 9
  • MLTNG
  • Myeloma cell metalloproteinase

Background

ADAM9 - a disintegrin and metalloproteinase domain 9 (meltrin gamma)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-33939
Species: Hu
Applications: WB, IHC, IHC-P
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF1031
Species: Hu
Applications: WB, IP, ICC
NBP1-69364
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-56605
Species: Av, Bv, Sh
Applications: WB
259-HE
Species: Hu
NBP2-55995
Species: Hu
Applications: ICC/IF
H00004185-M01
Species: Hu
Applications: WB, ELISA
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB4974
Species: Hu
Applications: IHC
H00008754-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ADAM9 Partial Recombinant Protein (H00008754-Q01) (0)

There are no publications for ADAM9 Partial Recombinant Protein (H00008754-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM9 Partial Recombinant Protein (H00008754-Q01) (0)

There are no reviews for ADAM9 Partial Recombinant Protein (H00008754-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM9 Partial Recombinant Protein (H00008754-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAM9 Products

Bioinformatics Tool for ADAM9 Partial Recombinant Protein (H00008754-Q01)

Discover related pathways, diseases and genes to ADAM9 Partial Recombinant Protein (H00008754-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM9 Partial Recombinant Protein (H00008754-Q01)

Discover more about diseases related to ADAM9 Partial Recombinant Protein (H00008754-Q01).
 

Pathways for ADAM9 Partial Recombinant Protein (H00008754-Q01)

View related products by pathway.

PTMs for ADAM9 Partial Recombinant Protein (H00008754-Q01)

Learn more about PTMs related to ADAM9 Partial Recombinant Protein (H00008754-Q01).
 

Research Areas for ADAM9 Partial Recombinant Protein (H00008754-Q01)

Find related products by research area.

Blogs on ADAM9

There are no specific blogs for ADAM9, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADAM9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM9
Entrez