ADAM22 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ADAM22 Antibody [NBP2-58310] - Staining of human cell line HEK 293 shows localization to cell junctions.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADAM22 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI
• Predicted Species: Mouse (91%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAM22
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ADAM22 Recombinant Protein Antigen (NBP2-58310PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADAM22 Antibody - BSA Free

• ADAM 22
• ADAM metallopeptidase domain 22
• ADAM22
• MDC2
• metalloproteinase-disintegrin ADAM22-3
• metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2
• MGC149832

Background

ADAM22 was first described as MDC2 (Metalloproteinase-like disintergin like cysteine rich 2) from analysis of human brain libraries, in search of brain-specific proteins. Two splice variants with different carboxyterminal ends have been described. ADAM22 participates in cell adhesion and spreading by associating with 14-3-3 proteins. It is constitutively produced in normal brain tissue, but decreased or absent in high grade gliomas. Different splice variants of ADAM22 are differentially expressed in areas of the brain. A complex of ADAM22 and LGI1 were shown to regulate synaptic transmission. Complexes of ADAM22, stargazing, and a range of other proteins anchor ADAM22 into the cytoskeleton, and keep ADAM22 in association with the postsynaptic space. ADAM22 does not contain the canonical HExxHxxxxxH zinc metalloproteinase motif, and is not thought to be proteolytically active. ADAM22 is a member of the ADAMS that function in tandem with other ADAMs and which may also have specific individual functions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAM22