ADAM22 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ADAM22 Antibody [NBP2-58310] - Staining of human cell line HEK 293 shows localization to cell junctions.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAM22 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI
Predicted Species
Mouse (91%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM22
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADAM22 Recombinant Protein Antigen (NBP2-58310PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ADAM22 Antibody

  • ADAM 22
  • ADAM metallopeptidase domain 22
  • ADAM22
  • MDC2
  • metalloproteinase-disintegrin ADAM22-3
  • metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2
  • MGC149832

Background

ADAM22 was first described as MDC2 (Metalloproteinase-like disintergin like cysteine rich 2) from analysis of human brain libraries, in search of brain-specific proteins. Two splice variants with different carboxyterminal ends have been described. ADAM22 participates in cell adhesion and spreading by associating with 14-3-3 proteins. It is constitutively produced in normal brain tissue, but decreased or absent in high grade gliomas. Different splice variants of ADAM22 are differentially expressed in areas of the brain. A complex of ADAM22 and LGI1 were shown to regulate synaptic transmission. Complexes of ADAM22, stargazing, and a range of other proteins anchor ADAM22 into the cytoskeleton, and keep ADAM22 in association with the postsynaptic space. ADAM22 does not contain the canonical HExxHxxxxxH zinc metalloproteinase motif, and is not thought to be proteolytically active. ADAM22 is a member of the ADAMS that function in tandem with other ADAMs and which may also have specific individual functions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4974
Species: Hu
Applications: IHC
H00009211-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-72042
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-67246
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92621
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
210-TA
Species: Hu
Applications: BA
NBP2-94660
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-395
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-88347
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF949
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, IP, KO, WB
DMD00
Species: Hu
Applications: ELISA
936-AD
Species: Hu
Applications: EnzAct
NBP2-30423
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DAD120
Species: Hu
Applications: ELISA
AF1376
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
930-ADB
Species: Hu
Applications: EnzAct
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-58310
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ADAM22 Antibody (NBP2-58310) (0)

There are no publications for ADAM22 Antibody (NBP2-58310).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM22 Antibody (NBP2-58310) (0)

There are no reviews for ADAM22 Antibody (NBP2-58310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAM22 Antibody (NBP2-58310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAM22 Products

Bioinformatics Tool for ADAM22 Antibody (NBP2-58310)

Discover related pathways, diseases and genes to ADAM22 Antibody (NBP2-58310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM22 Antibody (NBP2-58310)

Discover more about diseases related to ADAM22 Antibody (NBP2-58310).
 

Pathways for ADAM22 Antibody (NBP2-58310)

View related products by pathway.

PTMs for ADAM22 Antibody (NBP2-58310)

Learn more about PTMs related to ADAM22 Antibody (NBP2-58310).

Blogs on ADAM22

There are no specific blogs for ADAM22, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM22