ADAM22 Antibody

Images

 
Western Blot: ADAM22 Antibody [NBP1-69015] - Mouse Liver lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADAM22 Antibody Summary

Immunogen
Synthetic peptides corresponding to Adam22 (a disintegrin and metallopeptidase domain 22) The peptide sequence was selected from the N terminal of mouse Adam22 (NP_001007222). Peptide sequence AISENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGAAYIGGIC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Adam22 and was validated on Western blot; recognizes 91 kDa band.
Theoretical MW
91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ADAM22 Antibody

  • ADAM 22
  • ADAM metallopeptidase domain 22
  • ADAM22
  • MDC2
  • metalloproteinase-disintegrin ADAM22-3
  • metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2
  • MGC149832

Background

Adam22 is a probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Adam22 is involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation.Adam22 is a neuronal receptor for LGI1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4974
Species: Hu
Applications: IHC
NBP1-77320
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-55995
Species: Hu
Applications: ICC/IF
H00004185-M01
Species: Hu
Applications: WB, ELISA
NBP2-56992
Species: Hu
Applications: IHC-P
NB100-395
Species: Hu, Mu
Applications: IP (-), WB, ICC/IF, PLA
NBP1-88347
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF949
Species: Hu, Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-30423
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33939
Species: Hu
Applications: WB, IHC, IHC-P
AF1376
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
930-ADB
Species: Hu
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for ADAM22 Antibody (NBP1-69015) (0)

There are no publications for ADAM22 Antibody (NBP1-69015).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM22 Antibody (NBP1-69015) (0)

There are no reviews for ADAM22 Antibody (NBP1-69015). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM22 Antibody (NBP1-69015) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADAM22 Products

Bioinformatics Tool for ADAM22 Antibody (NBP1-69015)

Discover related pathways, diseases and genes to ADAM22 Antibody (NBP1-69015). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM22 Antibody (NBP1-69015)

Discover more about diseases related to ADAM22 Antibody (NBP1-69015).
 

Pathways for ADAM22 Antibody (NBP1-69015)

View related products by pathway.

PTMs for ADAM22 Antibody (NBP1-69015)

Learn more about PTMs related to ADAM22 Antibody (NBP1-69015).

Blogs on ADAM22

There are no specific blogs for ADAM22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM22
Entrez
Uniprot