ADAM22 Antibody - BSA Free

Western Blot: ADAM22 Antibody [NBP1-69015] - Mouse Liver lysate, concentration 0.2-1 ug/ml.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ADAM22 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to Adam22 (a disintegrin and metallopeptidase domain 22) The peptide sequence was selected from the N terminal of mouse Adam22 (NP_001007222). Peptide sequence AISENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGAAYIGGIC. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAM22
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: Recognizes 91 kDa band in WB.
• Theoretical MW: 91 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ADAM22 Antibody - BSA Free

• ADAM 22
• ADAM metallopeptidase domain 22
• ADAM22
• MDC2
• metalloproteinase-disintegrin ADAM22-3
• metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2
• MGC149832

Background

Adam22 is a probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Adam22 is involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation.Adam22 is a neuronal receptor for LGI1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAM22
• Entrez:
  • 53616(Human)
  • 11496(Mouse)
• Uniprot:
  • Q9R1V6(Mouse)